ESTScan Details for Unigene SGN-U283638

Score 
189
Direction 
Reverse
Predicted Peptide Sequence 
QWKWWEYCDSGTTFTFMNRGVFEPVLDAFGNKKGIPRSESIEIITGLRPCFNISRQETVSLPELKFHYKGGAEMTLPIANYFSFAGETDV
ICLTMVTDSAFGPELSTGPSDNSGQFSDAELLS
Predicted Coding Sequence 
XTCCAATGGAAATGGTGGGAGTATTGTGATTCAGGCACGACTTTCACTTTCATGAATCGCGGTGTTTTTGAGCCAGTACTTGATGCATTT
GGAAACAAGAAAGGTATTCCAAGAAGTGAGAGTATTGAGATAATAACAGGTTTAAGGCCATGTTTCAATATTTCCAGGCAAGAAACAGTG
TCTTTACCAGAGCTAAAGTTTCATTACAAAGGTGGTGCAGAGATGACATTGCCAATAGCAAATTACTTCTCATTTGCAGGTGAAACTGAT
GTGATTTGTTTAACTATGGTCACAGATAGTGCTTTTGGCCCTGAATTATCTACCGGTCCATCXGATAATTCTGGGCAATTTTCAGATGCA
GAATTACTTAGTTGA\
Edits in Original Sequence 
(5')XTCCAATGGAAATGGTGGGAGTATTGTGATTCAGGCACGACTTTCACTTTCATGAATCGCGGTGTTTTTGAGCCAGTACTTGATGC
ATTTGGAAACAAGtAAAGGTATTCCAAGAAGTGAGAGTATTGAGATAATAACAGGTTTAAGGCCATGTTTCAATATTTCCAGGCAAGAAA
CAGTGTCTTTACCAGAGCTAAAGTTTCATTACAAAGGTGGTGCAGAGATGACATTGCCAATAGCAAATTACTTCTCATTTGCAGGTGAAA
CTGATGTGATTTGTTTAACTATGGTCACAGATAGTGCTTTTGGCCCTGAATTATCTACCGGTCCATCXGATAATTCTGGGCAATTTTCAG
ATGCAGAATTACTTAGTTGA\(3')ATTTGATCTCAAAAATGAAAAGTTTGGCTTCAAGCAGCAAATGTGCAAATGAGAAAAAAAAGGCA
ATGGTGAAACTTTTAGTCCCTTTTTACTTGTAAGTTTTTGCACTACATAATTGAGGCTAATCACTCAAAGATTTGCCTTTTTGAGGCCTA
TGGTCTAGTGGTCAGTGGGGGTAGTAGATGATAACATTCAGAGGAATGTTTAGTTTTAGTTGTATAATGAATTAGAGGCCTCATATCATA
ATGGCTATTGCTGGAAGATTTAAATCAAGTGAAAATAAATGTACTTATTTCTGTGCTTAATGATATATAACAAGAACCAACATTTAAATT
TATGATTTAGAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan