ESTScan Details for Unigene SGN-U283733

Score 
386
Direction 
Forward
Predicted Peptide Sequence 
MDYFFWFFFSFAILVNSNLGSSADGPSINVTKHISFRDFSSSNPRLKQDLTLLGSVIVSDEKKSVQIPDPEREGDDLKHLAGRAIYSSPI
RFFDPRTQTPASFETTFSFQFEVKSNSSNETSDQGKSVGGSGLTFIIVPDELTVGRAGPWLGMLNDLCDEDYKTVAIEFDTRQNPEXGDP
NDNHLGINLGSIVSTAAIX
Predicted Coding Sequence 
ATGGATTACTTCTTCTGGTTTTTCTTCTCGTTTGCCATACTAGTTAATAGTAATTTAGGTTCGTCCGCGGACGGACCTTCAATTAACGTG
ACGAAGCATATCTCTTTTCGAGATTTCAGTTCTAGTAATCCCAGATTGAAGCAAGATCTTACACTTCTCGGTAGTGTTATCGTCTCGGAT
GAAAAAAAATCCGTTCAAATTCCTGATCCTGAGCGAGAAGGTGATGATCTAAAGCATCTAGCAGGACGAGCTATTTATTCTTCACCTATC
CGTTTCTTTGATCCTCGGACTCAAACACCGGCTTCCTTTGAAACGACTTTCTCGTTTCAATTTGAAGTGAAGTCCAATTCAAGCAATGAG
ACGTCAGATCAGGGGAAATCTGTTGGTGGTAGTGGCCTTACTTTTATAATCGTTCCGGATGAATTGACTGTTGGCCGTGCTGGTCCGTGG
CTTGGGATGCTGAACGATTTGTGCGATGAGGATTATAAAACAGTAGCTATTGAGTTTGATACTCGGCAGAACCCTGAAXTTGGTGACCCG
AATGATAATCACTTGGGCATTAATTTGGGTAGCATAGTATCAACTGCAGCGATTAXX\
Edits in Original Sequence 
TAAGTTCTCTTGTGTTTGGAAGAAAGTGAAATGAAGTTATCTATAGACCACATCCTTATGTACAACCTTGACAATTGATAATTTGCTACT
CAGAAAATTCAAATCCAAAAAAACTTTATCACTAGCCAAGAATTAGCTCATC
(5')ATGGATTACTTCTTCTGGTTTTTCTTCTCGTTTG
CCATACTAGTTAATAGTAATTTAGGTTCGTCCGCGGACGGACCTTCAATTAACGTGACGAAGCATATCTCTTTTCGAGATTTCAGTTCTA
GTAATCCCAGATTGAAGCAAGATCTTACACTTCTCGGTAGTGTTATCGTCTCGGATGAAAAAAAATCCGTTCAAATTCCTGATCCTGAGC
GAGAAGGTGATGATCTAAAGCATCTAGCAGGACGAGCTATTTATTCTTCACCTATCCGTTTCTTTGATCCTCGGACTCAAACACCGGCTT
CCTTTGAAACGACTTTCTCGTTTCAATTTGAAGTGAAGTCCAATTCAAGCAATGAGACGTCAGATCAGGGGAAATCTGTTGGTGGTAGTG
GCCTTACTTTTATAATCGTTCCGGATGAATTGACTGTTGGCCGTGCTGGTCCGTGGCTTGGGATGCTGAACGATTTGTGCGATGAGGATT
ATAAAACAGTAGCTATTGAGTTTGATACTCGGCAGAACCCTGAAXTTGGTGACCCGAATGATAATCACTTGGGCATTAATTTGGGTAGCA
TAGTATCAACTGCAGCGATTAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan