ESTScan Details for Unigene SGN-U283850

Score 
454
Direction 
Forward
Predicted Peptide Sequence 
QLVTKTVIPDIPLNNSLITMYAKCGKIQEAREIFEKMKFQKDVISWNAMVGGYASHGFAFEALELFELMKCLKVRPTHITFISVLNACAH
AGLVEQGRLYFKSMDSEFGIKPEIEHFGSLVDIIGRDGQLEEAMKVINTMPVEPDKAVWGAVLGACRVHSNVELARIAAEALMRLEPESS
GPYVLLYNMYADAGKWDDANEIRMLMETNKIRKEPAHSRXGSTSSXVISEIVNHDHSKNLD
Predicted Coding Sequence 
CAGTTAGTAACAAAGACTGTTATACCAGATATACCTTTAAACAATTCCCTAATAACTATGTATGCAAAATGTGGCAAAATACAAGAAGCA
AGGGAAATTTTTGAAAAGATGAAATTTCAAAAGGACGTAATCTCATGGAATGCAATGGTCGGAGGATATGCATCTCATGGTTTTGCATTT
GAAGCGCTAGAGCTTTTTGAATTAATGAAGTGCCTTAAAGTGAGGCCAACTCATATCACGTTCATTTCAGTTCTGAATGCATGTGCTCAT
GCTGGTTTAGTGGAACAAGGTCGGTTATATTTTAAATCTATGGACTCTGAATTCGGCATCAAACCTGAGATTGAACATTTTGGCTCCCTT
GTGGATATTATTGGTCGAGATGGGCAGCTTGAGGAGGCCATGAAAGTGATTAACACTATGCCAGTGGAGCCAGATAAGGCTGTCTGGGGT
GCAGTGCTAGGTGCTTGTAGGGTGCACAGCAATGTTGAGTTGGCGCGAATTGCAGCTGAAGCGCTAATGCGCCTGGAACCGGAGAGTTCA
GGCCCTTATGTTTTGCTGTATAACATGTATGCCGATGCTGGAAAGTGGGATGATGCAAATGAAATCAGAATGTTGATGGAAACAAATAAG
ATAAGGAAGGAGCCTGCTCATAGCAGGNTCGGTTCTACTTCCTCTXTAGTGATTTCTGAAATTGTGAATCATGATCACTCGAAGAATTTG
GATTGA\
Edits in Original Sequence 
(5')CAGTTAGTAACAAAGACTGTTATACCAGATATACCTTTAAACAATTCCCTAATAACTATGTATGCAAAATGTGGCAAAATACAAGA
AGCAAGGGAAATTTTTGAAAAGATGAAATTTCAAAAGGACGTAATCTCATGGAATGCAATGGTCGGAGGATATGCATCTCATGGTTTTGC
ATTTGAAGCGCTAGAGCTTTTTGAATTAATGAAGTGCCTTAAAGTGAGGCCAACTCATATCACGTTCATTTCAGTTCTGAATGCATGTGC
TCATGCTGGTTTAGTGGAACAAGGTCGGTTATATTTTAAATCTATGGACTCTGAATTCGGCATCAAACCTGAGATTGAACATTTTGGCTC
CCTTGTGGATATTATTGGTCGAGATGGGCAGCTTGAGGAGGCCATGAAAGTGATTAACACTATGCCAGTGGAGCCAGATAAGGCTGTCTG
GGGTGCAGTGCTAGGTGCTTGTAGGGTGCACAGCAATGTTGAGTTGGCGCGAATTGCAGCTGAAGCGCTAATGCGCCTGGAACCGGAGAG
TTCAGGCCCTTATGTTTTGCTGTATAACATGTATGCCGATGCTGGAAAGTGGGATGATGCAAATGAAATCAGAATGTTGATGGAAACAAA
TAAGATAAGGAAGGAGCCTGCTCATAGCAGGNTCGGTTCTACTTCCTCTXTAGTGATTTCTGAAATTGTGAATCATGATCACTCGAAGAA
TTTGGATTGA\(3')GTTGACTGGGGTTTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan