ESTScan Details for Unigene SGN-U283864

Score 
289
Direction 
Forward
Predicted Peptide Sequence 
RERTVLQPSPAAAVDILPAVAYLDNPSTSFAAKFVHTSLNKNLVQSIVLRGXPSGRRLVTGSQSGEFTLWNGQSFNFEMILQAHDQAVRS
MVWSHNDNWMVTGDDGGTLKYWQNNMNNVKAHKNAHKESIRELSFCSTDLKFCSCSDDTTVKIWDFARCQEERSLSGHGWDVKSVDWHPT
KSLLVSGGKDNLVKL
Predicted Coding Sequence 
XXGAGAGAGAGGACAGTGTTACAACCTAGCCCAGCAGCAGCAGTTGATATATTGCCAGCAGTTGCCTATTTGGATAATCCATCCACAAGT
TTTGCTGCTAAATTTGTTCATACATCTCTAAATAAAAACCTTGTTCAATCAATTGTCTTGCGTGGAXCTCCTAGTGGGCGGCGCCTTGTT
ACTGGATCTCAAAGTGGTGAATTCACACTATGGAATGGGCAATCATTTAACTTTGAAATGATACTTCAGGCTCATGATCAAGCAGTCAGG
TCAATGGTATGGAGCCACAATGATAACTGGATGGTCACTGGTGATGATGGGGGGACACTGAAGTATTGGCAAAACAATATGAATAATGTC
AAAGCCCATAAGAATGCACATAAAGAATCAATACGAGAATTGAGCTTCTGTAGTACAGATTTAAAATTCTGCTCCTGCTCTGACGACACT
ACCGTTAAAATATGGGACTTTGCAAGGTGCCAAGAAGAGCGCTCATTATCTGGCCATGGTTGGGATGTGAAGAGTGTTGATTGGCACCCT
ACAAAGTCTCTATTAGTCTCAGGTGGAAAAGATAATCTTGTTAAACTX\
Edits in Original Sequence 
(5')XXGAGAGAGAGGACAGTGTTACAACCTAGCCCAGCAGCAGCAGTTGATATATTGCCAGCAGTTGCCTATTTGGATAATCCATCCAC
AAGTTTTGCTGCTAAATTTGTTCATACATCTCTAAATAAAAACCgTTGTTCAATCAATTGTCTTGCGTGGAXCTCCTAGTGGGCGGCGCC
TTGTTACTGGATCTCAAAGTGGTGAATTCACACTATGGAATGGGCAATCATTTAACTTTGAAATGATACTTCAGGCTCATGATCAAGCAG
TCAGGTCAATGGTATGGAGCCACAATGATAACTGGATGGTCACTGGTGATGATGGGGGGACACTGAAGTATTGGCAAAACAATATGAATA
ATGTCAAAGCCCATAAGAATGCACATAAAGAATCAATACGAGAATTGAGCTTCTGTAGTACAGATTTAAAATTCTGCTCCTGCTCTGACG
ACACTACCGTTAAAATATGGGACTTTGCAAGGTGCCAAGAAGAGCGCTCATTATCTGGCCATGGTTGGGATGTGAAGAGTGTTGATTGGC
ACCCTACAAAGTCTCTATTAGTCTCAGGTGGAAAAGATAATCTTGTTAAACTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan