Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U283929

Score 
485
Direction 
Forward
Predicted Peptide Sequence 
KNILQVIDETMWLASSLSEPQNSXVFPFSSHANEEGAELTTPRIPKSWIITSNLNLDLKLTKLEEYEYDDSYHDNLCNNDNKVSVGSPSF
FTNYPLMSALIAFALAQSTKLFTSWYKERRWDLKQLVGSGGMPSSHSSTVTALAVAVGLQEGFGGALFACALVLACVVMYDATGVRLHAG
RQAEVLNQILYELPSEHPLADSRPLRELLGHTPPQVVAGGXIGIDDCNGYSFYHRLRASSMTLKKRLLTMLQFVKYDICDIRPKVADISF
HL
Predicted Coding Sequence 
XXAAAGAATATTCTTCAAGTCATTGATGAAACCATGTGGTTGGCTTCTTCATTGTCTGAACCCCAAAATAGCXTCGTGTTCCCATTTTCC
TCACACGCAAACGAGGAAGGAGCAGAACTCACAACACCTCGTATTCCCAAATCTTGGATTATAACTTCAAATCTGAATCTTGATTTGAAA
CTCACGAAATTAGAAGAATATGAATACGATGACAGCTACCATGACAACCTCTGCAACAACGACAACAAGGTCTCTGTCGGGTCACCTTCA
TTTTTCACTAATTATCCACTTATGTCTGCTCTTATTGCCTTTGCTCTTGCCCAATCCACCAAGCTCTTCACTTCATGGTACAAGGAAAGA
CGATGGGATCTTAAGCAACTTGTTGGATCTGGTGGAATGCCATCATCCCATTCATCAACTGTAACTGCTCTAGCTGTGGCTGTTGGTTTG
CAGGAGGGCTTTGGGGGAGCACTCTTTGCTTGTGCATTAGTTTTAGCGTGTGTGGTCATGTATGATGCCACGGGTGTAAGATTACATGCT
GGACGTCAGGCAGAGGTCCTGAATCAAATTTTGTACGAACTTCCTTCTGAACATCCTCTTGCAGATAGCAGACCATTACGAGAACTCCTT
GGTCACACTCCTCCTCAGGTTGTAGCCGGTGGAXTTATTGGGATTGACGACTGCAACGGCTATTCATTTTATCACAGGCTCAGGGCATCA
AGCATGACATTAAAGAAGCGGTTGCTTACTATGTTACAGTTTGTGAAATATGATATATGTGATATCAGGCCAAAAGTTGCAGATATCTCA
TTTCACCTCTGA\
Edits in Original Sequence 
(5')XXAAAGAATATTCTTCAAGTCATTGATGAAACCATGTGGTTGGCTTCTTCATTGTCTGAACCCCAAAATAGCXTCGTGTTCCCATT
TTCCTCACACGCAAACGAGGAAGGAGCAGAACTCACAACACCTCGTATTCCCAAATCTTGGATTATAACTTCgAAATCTGAATCTTGATT
TGAAACTCACGAAATTAGAgAGAATATGAATACGATGACAGCTACCATGACAACCTCTGCAACAACGACAACAAcGGTCTCTGTCGGGTC
ACCTTCATTTTTCACTAATTATCCACTTATGTCTGCTCTTATTGCCTTTGCTCTTGCCCAATCCACCAAGCTCTTCACTTCATGGTACAA
GGAAAGACGATGGGATCTTAAGCAACTTGTTGGATCTGGTGGAATGCCATCATCCCATTCATCAACTGTAACTGCTCTAGCTGTGGCTGT
TGGTTTGCAGGAGGGCTTTGGGGGAGCACTCTTTGCTTGTGCATTAGTTTTAGCGTGTGTGGTCATGTATGATGCCACGGGTGTAAGATT
ACATGCTGGACGTCAGGCAGAGGTCCTGAATCAAATTTTGTACGAACTTCCTTCTGAACATCCTCTTGCAGATAGCAGACCATTACGAGA
ACTCCTTGGTCACACTCCTCCTCAGGTTGTAGCCGGTGGAXTTATTGGGATTGACGACTGCAACGGCTATTCATTTTATCACAGGCTCAG
GGCATCAAGCATGACATTAAAGAAGCGGTTGCTTACTATGTTACAGTTTGTGAAATATGATATATGTGATATCAGGCCAAAAGTTGCAGA
TATCTCATTTCACCTCTGA\(3')ATTGTGCTGGATGGTATTGACTGCAGAGATGTACTAATATTTCAGATACCTCATTGCCTCCTAACA
GGTTCAGAATTGCTAATATTCATTTAGAAGTTTATACACTTTATACATAATGTAGATAATTATTAGCTACAATGAACTGCAACCTGTAAG
TTAAGCTGCACACTTTTCAGAAAATTAGTTACAGTGTGTTAAATGTTTTTCTGTATTAAACAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan