ESTScan Details for Unigene SGN-U283975

Score 
539
Direction 
Forward
Predicted Peptide Sequence 
MANPKSQSSPRAKIADTIINTVLSPIVIAPSTLLSNLTPNLILLILSDPHINTPKCLDFFNFLMLNQSFITFKIGVETHLTLVCRLVKEG
YFEDAETLLVLVPNIETFRCPFAVIASFFENHNVPSKFASKIFNLLLKALSDNGKFNEALEIFMYMKLNAIEINERTCTVHLINLLKCDQ
IALALVFFYQMVESXIQVSVFSLTVVVDGLCX
Predicted Coding Sequence 
ATGGCAAATCCCAAATCCCAGTCTTCACCTAGAGCAAAAATTGCAGACACCATTATCAATACAGTGCTAAGCCCCATAGTCATTGCACCC
TCTACTCTTCTCTCCAACCTCACTCCCAATTTGATTCTCCTTATTTTATCTGACCCACATATCAACACACCTAAATGCCTCGACTTCTTC
AATTTCCTTATGCTTAATCAATCTTTCATTACTTTCAAGATTGGTGTTGAAACCCACTTGACACTTGTTTGCAGGCTTGTCAAAGAAGGA
TACTTTGAAGATGCTGAGACCCTTTTAGTTTTAGTCCCAAATATTGAAACTTTCAGGTGCCCTTTTGCTGTTATAGCTTCTTTCTTTGAG
AATCACAATGTTCCATCAAAGTTTGCTTCGAAAATATTCAATTTGCTTCTTAAAGCTTTATCTGATAACGGAAAATTCAACGAGGCTTTA
GAGATTTTCATGTATATGAAACTAAATGCAATTGAGATTAATGAGAGAACATGTACTGTTCATTTGATTAATCTTTTGAAGTGTGATCAG
ATCGCGTTAGCGCTGGTATTCTTTTATCAAATGGTTGAATCANGTATTCAGGTTTCAGTATTTTCGTTGACGGTCGTGGTAGATGGATTG
TGTAXX\
Edits in Original Sequence 
AAAA(5')ATGGCAAATCCCAAATCCCAGTCTTCAcCCTAGAGCAAAAATTGCAGACACCATTATCAATACAGTGCTAAGCCCCATAGTC
ATTGCACCCTCTACTCTTCTCTCCAACCTCACTCCCAATTTGATTCTCCTTATTTTATCTGACCCACATATCAACACACCTAAATGCCTC
GACTTCTTCAATTTCCTTATGCTTAATCAATCTTTCATTACTTTCAAGATTGGTGTTGAAACCCACTTGACACTTGTTTGCAGGCTTGTC
AAAGAAGGATACTTTGAAGATGCTGAGACCCTTTTAGTTTTAGTCCCAAATATTGAAACTTTCAGGTGCCCTTTTGCTGTTATAGCTTCT
TTCTTTGAGAATCACAATGTTCCATCAAAGTTTGCTTCGAAAATATTCAATTTGCTTCTTAAAGCTTTATCTGATAACGGAAAATTCAAC
GAGGCTTTAGAGATTTTCATGTATATGAAACTAAATGCAATTGAGATTAATGAGAGAACATGTACTGTTCATTTGATTAATCTTTTGAAG
TGTGATCAGATCGCGTTAGCGCTGGTATTCTTTTATCAAATGGTTGAATCANGTATTCAGGTTTCAGTATTTTCGTTGACGGTCGTGGTA
GATGGATTGTGTAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan