ESTScan Details for Unigene SGN-U283980

Score 
220
Direction 
Forward
Predicted Peptide Sequence 
NGKIEELIDDKLGSQFSKAEAERIIKVALLCTSATPSLRPVMSEAVGMLEGKIDAPDSIPEASMYTDDLRFQALKDFQQERQNQSASSNQ
AQCSSIQTASDLCEYNPESRSDDSLLCVYSYLSLAGVPVSYGSXRDCIGSKPLIEV
Predicted Coding Sequence 
XAAAATGGAAAAATAGAGGAGCTGATTGATGATAAATTGGGTTCTCAGTTTAGCAAAGCAGAAGCAGAAAGGATAATAAAAGTAGCACTA
TTATGCACTAGTGCGACGCCATCACTCAGGCCTGTAATGTCTGAGGCTGTAGGCATGCTTGAAGGAAAAATAGATGCCCCTGATAGTATC
CCAGAAGCAAGTATGTATACTGACGATTTGAGATTTCAAGCCTTGAAAGATTTCCAACAAGAGAGGCAAAATCAAAGTGCGTCAAGTAAT
CAAGCTCAGTGTTCAAGCATCCAAACTGCCTCTGATCTCTGTGAATACAACCCCGAATCAAGATCTGATGACTCTCTATTGTGTGTGTAT
TCTTATTTATCTCTTGCTGGTGTGCCTGTATCTTATGGCTCAXTGAGGGATTGCATTGGTTCAAAGCCACTCATCGAGGTATGA\
Edits in Original Sequence 
(5')XAAAATGGAAAAATAGAGGAGCTGATTGATGATAAATTGGGTTCTCAGTTTAGCAAAGCAGAAGCAGAAAGGATAATAAAAGTAGC
ACTATTATGCACTAGTGCGACGCCATCACTCAGGCCTGTAATGTCTGAGGCTGTAGGCATGCTTGAAGGAAAAATAGATGCCCCTGATAG
TATCCCAGAAGCAAGTATGTATACTGACGATTTGAGATTTCAAGCCTTGAAAGATTTCCAACAAGAGAGGCAAAATCAAAGTGCGTCAAG
TAATCAAGCTCAGTGTTCAAGCATCCAAACTGCCTCTGATCTCTGTGAATACAACCCCGAATCAAGATCTGAcTGACTCTCTATTGTGTG
TGTATTCTTATTTaATCTCTTGCTGGTGTGCCTGTATCTTATGGCTCAXTGAGGGATTGCATTGGTTCAAAGCCACTCATCGAGGTATGA
\(3')TTGTTGTAAGTTGTAACTATTTGTTCAATTTTTTGTGAGTAAGATTTCTATAAAATGTACATAAATTACTATCCCAAGAAAAAGT
GTGAGAAGTTATATTTCTCCAGGTCTGCATTTTTGCACCTCCTAGCTAGATTTCCAAGTTGTATAAAGATTCTGGCCCATTGTGATATAC
CTGAAATGTAGACTATAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan