ESTScan Details for Unigene SGN-U284033

Score 
432
Direction 
Reverse
Predicted Peptide Sequence 
RGYIGDLMGAPFVHCACETADLGMLELLMQYSANVNASDSSGQTPLHWCIIRGKAAFAKLLLARGADPHALDGESKTPYDLALGSNFDDV
DVLNLLSDANAYTFKRVYTKRGQRLKLYPLFXNDTRVSVLCNYASKFCADRSPSKDTAACALRALNVACCGLQDSWGLRVRIFY
Predicted Coding Sequence 
XTGAGAGGTTATATTGGGGACTTGATGGGTGCTCCGTTTGTACACTGTGCTTGTGAAACAGCTGACCTAGGGATGCTAGAGCTTCTTATG
CAATACAGTGCAAATGTAAATGCTTCAGATTCAAGTGGTCAGACACCACTTCATTGGTGTATTATAAGAGGCAAAGCTGCATTTGCTAAG
TTGCTTCTTGCAAGGGGTGCTGATCCACATGCTTTGGATGGGGAAAGTAAAACCCCTTACGATCTTGCATTGGGCTCAAATTTTGATGAC
GTTGATGTCCTTAATCTCTTGTCAGACGCAAATGCTTATACATTCAAGAGAGTATATACCAAACGTGGACAGAGATTGAAGCTGTACCCT
TTGTTTGAXAATGATACCAGGGTTTCAGTTCTTTGTAATTATGCTAGTAAATTTTGTGCTGACAGATCTCCATCGAAAGACACCGCTGCT
TGTGCATTAAGGGCCCTCAATGTTGCATGTTGTGGTCTGCAAGATTCCTGGGGACTACGCGTCCGAATCTTCTATTGA\
Edits in Original Sequence 
(5')XTGAGAGGTTATATTGGGGACTTGATGGGTGCTCCGTTTGTACACTGTGCTTGTGAAACAGCTGACCTAGGGATGCTAGAGCTTCT
TATGCAATACAGTGCAAATGTAAATGCTTCAGATTCAAGTGGTCAGACACCACTTCATTGGTGTATTATAAGAGGCAAAGCTGCATTTGC
TAAGTTGCTTCTTGCAAGGGGTGCTGATCCACATGCTTTGGATGGGGAAAGTAAAACCCCTTACGATCTTGCATTGGGCTCAAATTTTGA
TGACGTTGATGTCCTTAATCTCTTGTCAGACGCAAATGCTTaATACATTCAAGAGAGTATATACCAAACGTGGACAGAGATTGAAGCTGT
ACCCTTTGTTTGAXAATGATACCAGGGTTTCAGTTCTTTGTAATTATGCTAGTAAATTTTGTGCTGACAGATCTCCATCGAAAGACACCG
CTGCTTGTGCATTAAGGGCCCTCAATGTTGCATGTTGTGGTCTGCAAGATTCCTGGGGACTACGCGTCCGAATCTTCTATTGA\(3')AG
TAGAATGTTAGGGTGGTCTTTCATGCTTGATTTTGGAGGTCAGATGCATTGGAGGGTTGCAGTCTTTTTGTGTTGTAAAGCTGTTTTTTC
ACTTAGCAGTTTTATTGGTTTTTGTTTTTAGAGTTTTTTGTGGCAGGTTCTAGGCATTGGCCTTGGGTGCTGGTATTTTGTGTACATTTT
GCTGTTAATTTTAACTTTTGTGGTGTAGCCTTTGTAATTTGTATATCTAAATCTAAGTGTTATTTTAACTGAGGGAAAAAAAAAAATCAT
ACCCTCGTGCCGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan