ESTScan Details for Unigene SGN-U284146

Score 
246
Direction 
Forward
Predicted Peptide Sequence 
MAQKEIMEQQDIRKLDVTKLHPLSPEVISRQPTINIGLIGHVAHGKTTLVRAISGIQVANLTLMFIDLSTLLVWYNLLLYGTLCLFYXHL
IFRRLDSNXELERNITVKLGYANGKIYKCEDESCPEXLCYMSYGSGKEDNPPX
Predicted Coding Sequence 
ATGGCTCAGAAAGAGATAATGGAGCAGCAGGATATAAGGAAGCTTGATGTAACTAAGTTACATCCGCTTTCTCCCGAAGTTATATCCAGG
CAGCCTACAATCAACATTGGCCTCATTGGCCATGTAGCACATGGAAAAACAACCCTTGTCAGAGCAATCTCTGGTATCCAGGTAGCCAAC
CTTACTCTTATGTTTATAGACCTTTCAACACTTTTGGTTTGGTATAATCTTCTTCTATATGGAACTCTTTGTTTGTTTTATGXTCATCTA
ATTTTCAGACGACTCGATTCCAATGXTGAACTGGAGCGTAACATAACTGTGAAACTTGGGTATGCAAATGGCAAAATTTACAAATGTGAG
GATGAAAGTTGTCCGGAANCTTTATGCTACATGTCATATGGAAGTGGTAAAGAAGATAATCCTCCATXX\
Edits in Original Sequence 
CCACATTCGCCATTTTTATGAATGAATAACCCTAACTCACCATGACAGTTTTAGCCTAAGAAAGTTTTTTCTCTACTTTCAAACTTAGCA
CCATGGCCATCTTCTTCATTATCATCATAGCAGCACTATTAGTATTAGTACCAAATTCAGAAACTCCCATCAGAAAAACAGATCTTGAAA
GACCTTTTGAAATAAGTTTCTCTATTCCAAGGATTCTGA
(5')ATGGCTCAGAAAGAGATAATGGAGCAGCAGGATATAAGGAAGCTTGA
TGTAACTAAGTTACATCCGCTTTCTCCCGAAGTTATATCCAGGCAGCCTACAATCAACATTGGCCTCATTGGCCATGTAGCACATGGAAA
AACAACCCTTGTCAGAGCAATCTCTGGTATCCAGGTAGCCAtACCTTACTCTTATGTTTATAGACCTTTCAACACTTTTGGTTTGGTATA
ATCTTCTTCTATATGGAACTCTTTGTTTGTTTTATGXTCATCTAATTTTCAGACGACTCGATTCCAATGXTGAACTGGAGCGTAACATAA
CTGTGAAACTTGGGTATGCAAATGGCAAAATTTACAAATGTGAGGATGAAAGTTGTCCGGAANCTTTATGCTACATGTCATATGGAAGTG
GTAAAGAAGATAATCCTCCATXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan