ESTScan Details for Unigene SGN-U284310

Score 
173
Direction 
Reverse
Predicted Peptide Sequence 
ATLLLVALVLTSFLIPATIAGSDFCDSKCNYXVFKGRTTGQMLKXIVEYVVQSVTAVPSGTSGNKDECPCYRDKKNSKGGPKCP
Predicted Coding Sequence 
XTTGCAACGTTGCTTTTGGTGGCACTTGTTCTTACTTCTTTCCTCATTCCAGCCACTATTGCTGGTTCAGATTTCTGTGATTCAAAGTGC
AACTATAXGGTGTTCAAAGGCAGGACGACAGGACAGATGCTTAAAGXTATTGTGGAATATGTTGTACAGAGTGTCACTGCXGTTCCTTCT
GGAACTAGTGGAAATAAAGATGAGTGTCCTTGCTATAGGGACAAGAAAAACTCCAAGGGAGGGCCTAAATGTCCTTAA\
Edits in Original Sequence 
(5')XTTGCAACGTTGCTTTTGGTGGCACTTGTTCTTACTTCTTTCCTCATTCCAGCCACTATTGCTGGTTCAGATTTCTGTGATTCAAA
GTGCAACTATAXGGTGTTCAAAGGCAGGACGACAGGACAGATGCTTAAAGXTATTGTGGAATATGTTGTACAGAGTGTCACTGCXGTTCC
TTCTGGAACTAGTGGAAATAAAGATGAGTGTCCTTGCTATAGGGACAAGAAAAACTCCAAGGGAGGGCCTAAATGTCCTTAA\(3')ATT
TACTTAATCTTTTCCCCAAATTGTTGTTTGTCAAACACAAAGATAGAGGTTCAAAGCCTTGATGTGCCATGTTTGTCATGAAATAAGGTT
GATTATAATAAATAAAAAAAACAAATAAGTGAACAAAAAACATGCAGCGCGGGGGATCACTAGTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan