ESTScan Details for Unigene SGN-U284353

Score 
974
Direction 
Forward
Predicted Peptide Sequence 
NDAVGGTGNSVDLVVESGYKIIWVPLKVQHVLKKQGINGPGYSPILNNTAKIRRLMIAEAESKSSCFTHNHETVVSRVMPHYYNWSTIYG
KNFLYWFGPKPRVAIADPNLIKEILLNTTSFEKIKHNPLSKLLLGDGLVGLDGHKWAIHRRISNHAFNMEIVKGWISEMVDSTTKLLDKW
KDITSARDQFEMDVHKEFHKLSADIISRTAFGSSFEEGKRIFELQDQQVSLVLEAIRSVYIPGFRFLPTKKNRLRKRLEKETRDAIRMLL
NNCSRTANNSKSLLSLLMHPIKNQDDKQETLDIEEVVDECKTFYFAGKETTANFLTWAFLLLALHQEWQSKAREEVVRACRNGIPSAENX
Predicted Coding Sequence 
XXCAATGATGCTGTTGGTGGCACTGGCAATAGTGTTGATCTTGTTGTTGAAAGTGGATACAAAATCATATGGGTCCCTTTAAAAGTGCAA
CATGTGTTGAAGAAACAAGGCATAAATGGACCAGGTTACAGCCCAATTTTGAACAACACAGCAAAGATTAGAAGATTGATGATAGCAGAA
GCTGAATCAAAGTCCAGCTGTTTCACTCATAATCATGAAACAGTAGTTTCCCGTGTCATGCCACACTATTATAATTGGTCAACGATTTAT
GGAAAGAATTTTCTTTACTGGTTTGGTCCTAAACCTAGGGTTGCAATTGCTGATCCCAATCTCATAAAGGAGATATTGCTTAATACCACT
TCCTTTGAGAAAATCAAACATAACCCTTTGTCAAAACTTCTGCTTGGAGATGGGCTTGTTGGGTTAGATGGTCACAAATGGGCTATTCAC
AGAAGGATCAGCAACCACGCCTTTAACATGGAGATAGTAAAGGGTTGGATTTCTGAGATGGTTGATAGTACAACAAAGTTGTTGGACAAG
TGGAAAGACATAACAAGTGCAAGAGACCAGTTTGAGATGGATGTACACAAAGAATTTCACAAACTTTCAGCAGACATCATTTCTAGGACC
GCTTTTGGAAGTAGTTTTGAGGAGGGAAAGCGTATTTTTGAATTACAAGACCAGCAAGTGAGCCTTGTTTTAGAGGCCATACGAAGTGTC
TACATTCCTGGATTCAGATTTTTGCCCACCAAGAAGAACAGATTGAGGAAAAGACTGGAGAAGGAAACTAGAGATGCAATTAGGATGTTG
TTAAACAATTGCAGCAGAACAGCAAACAATTCGAAAAGCTTGCTTTCTTTGTTAATGCATCCAATCAAGAATCAGGATGACAAACAGGAG
ACACTGGATATAGAGGAGGTTGTAGATGAATGCAAGACATTCTACTTTGCAGGAAAGGAGACAACTGCTAATTTTCTGACATGGGCTTTT
CTTCTGTTGGCATTGCATCAAGAATGGCAGAGCAAGGCTCGGGAAGAAGTTGTTCGTGCTTGCAGAAATGGGATTCCTTCTGCAGAGAAT
AXX\
Edits in Original Sequence 
(5')XXCAATGATGCTGTTGGTGGCACTGGCAATAGTGTTGATCTTGTTGTTGAAAGTGGtATACAAAATCATATGGGTCCCTTTAAAAG
TGCAACATGTGTTGAAGAAACAAGGCATAAATGGACCAGGTTACAGCCCAATTTTGAACAACACAGCAAAGATTAGAAGATTGATGATAG
CAGAAGCTGAATCAAAGTCCAGCTGTTTCACTCATAATCATGAAACAGTAGTTTCCCGTGTCATGCCACACTATTATAATTGGTCAACGA
TTTATGGAAAGAATTTTCTTTACTGGTTTGGTCCTAAACCTAGGGTTGCAATTGCTGATCCCAATCTCATAAAGGAGATATTGCTTAATA
CCACTTCCTTTGAGAAAATCAAACATAACCCTTTGTCAAAACTTCTGCTTGGAGATGGGCTTGTTGGGTTAGATGGTCACAAATGGGCTA
TTCACAGAAGGATCAGCAACCACGCCTTTAACATGGAGATAGTAAAGGGTTGGATTTCTGAGATGGTTGATAGTACAACAAAGTTGTTGG
ACAAGTGGAAAGACATAACAAGTGCAAGAGACCAGTTTGAGATGGATGTACACAAAGAATTTCACAAACTTTCAGCAGACATCATTTCTA
GGACCGCTTTTGGAAGTAGTTTTGAGGAGGGAAAGCGTATTTTTGAATTACAAGACCAGCAAGTGAGCCTTGTTTTAGAGGCCATACGAA
GTGTCTACATTCCTGGATTCAGATTTTTGCCCACCAAGAAGAACAGATTGAGGAAAAGACTGGAGAAGGAAACTAGAGATGCAATTAGGA
TGTTGTTAAACAATTGCAGCAGAACAGCAAACAATTCGAAAAGCTTGCTTTCTTTGTTAATGCATCCAATCAAGAATCAGGATGACAAAC
AGGAGACACTGGATATAGAGGAGGTTGTAGATGAATGCAAGACATTCTACTTTGCAGGAAAGGAGACAACTGCTAATTTTCTGACATGGG
CTTTTCTTCTGTTGGCATTGCATCAAGAATGGCAGAGCAAGGCTCGGGAAGAAGTTGTTCGTGCTTGCAGAAATGGGATTCCTTCTGCAG
AGAATAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan