ESTScan Details for Unigene SGN-U284462

Score 
328
Direction 
Forward
Predicted Peptide Sequence 
MTRIIPAEIFPQCPFFSNNLKPKSQSSKHNFVVRCSSSSNDQSKIQIRNPQRVKISSENRPTHDMKVLNWSCKVGKYDETLYLLECKVKS
GYKPDVILCTKLIKGFCNSKNSDKGGEVMQIFEQFGEPDVFAYNALXSGFL
Predicted Coding Sequence 
ATGACTAGGATTATTCCAGCTGAAATATTTCCTCAATGTCCCTTTTTCTCCAATAATTTGAAGCCAAAATCTCAATCTTCAAAGCATAAT
TTTGTTGTAAGATGTAGTAGTAGTAGCAATGACCAAAGTAAAATACAGATTAGAAATCCTCAAAGGGTCAAAATTTCTAGTGAAAATAGA
CCTACACATGATATGAAAGTGCTAAATTGGTCATGTAAAGTAGGCAAATATGATGAAACTTTGTATCTACTTGAATGTAAGGTGAAGAGT
GGTTATAAACCTGATGTGATTCTGTGTACAAAGCTCATTAAGGGGTTTTGCAACTCGAAAAATTCGGATAAAGGGGGTGAAGTTATGCAA
ATTTTTGAGCAATTTGGTGAACCAGATGTGTTTGCATATAATGCACTTATNAGTGGATTTTTGTAA\
Edits in Original Sequence 
TTTTTCTCTTCTTAATTCAATTCAAACATGATTTGTCTCGAAAGCTCATATTGCCGACTCTAACTTGTCTGAGACTGAGACTTAGTTGTA
TTAAGGGGTCGGGAAGTCTTGTATAGCCAACTCTTAACTTGTTTGGGATCGAGGCATGGTTTTTTGTTATTGTGATTTAGTGTTTGAGAG
ACTTTCACTGATACGACTAGACCAA
(5')ATGACTAGGATTATTCCAGCTGAAATATTTCCTCAATGTCCCTTTTTCTCCAATAATTTGA
AGCCAAAATCTCAATCTTCAAAGCATAATTTTGTTGTAAGATGTAGTAGTAGTAGCAATGACCAAAGTAAAATACAGATTAGAAATCCTC
AAAGGGTCAAAATTTCTAGTGAAAATAGACCTACACATGATATGAAAGTGCTAAATTGGTCATGTAAAGTAGGCAAATATGATGAAACTT
TGTATCTACTTGAATGTAAGGTGAAGAGTGGTTATAAACCTGATGTGATTCTGTGTACAAAGCTCATTAAGGGGTTTTGCAACTCGAAAA
ATTCGGATAAAGGGGGTGAAGTTATGCAAATTTTTGAGCAATTTGGTGAACCAGATGTGTTTGCATATAATGCACTTATNAGTGGATTTT
TGTAA\(3')ATGAAACAGATTGAAGAAAGCCANTAGGTGGTGAATAGGATGAAAGCTCGTGGCTTTCCTCCGGATCTGTTACGTATATA
TCTTGATAGGTAGTCTTTGTGATAGAGGGAAACTANGATCAGCATTGAAGTTGTTGGATCAGTTGAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan