ESTScan Details for Unigene SGN-U284472

Score 
375
Direction 
Forward
Predicted Peptide Sequence 
MNGFMRPNYFXDEMRRVGVDPNHVTYSIFIHHLYKNKAEKVAANFQSQIVIRGVPFDVVLFTSLINGLFKIGKSREAKDVFQTLLKSNIT
PNHITYTALVDGHCKSGDLKSVEILLQQMEQKGVLPNVVTFSSVINGYAKSGMVEAAIEIMRKMVSINVNPNVFTYNTLIDGCFKAGKHD
MALALYX
Predicted Coding Sequence 
ATGAACGGTTTCATGAGGCCAAATTACTTCTXTGATGAGATGAGAAGAGTGGGTGTGGATCCTAATCACGTGACATACTCTATTTTTATT
CATCACTTGTACAAAAATAAGGCCGAAAAGGTTGCTGCTAACTTCCAAAGTCAAATAGTGATTAGAGGAGTGCCTTTCGATGTTGTCTTG
TTTACCTCTTTGATAAATGGGCTTTTTAAAATTGGAAAATCCAGGGAGGCAAAAGACGTGTTTCAGACACTCTTGAAGTCTAACATAACT
CCAAATCATATTACCTATACTGCATTGGTTGATGGGCACTGCAAATCTGGTGACTTAAAGAGTGTAGAGATTTTACTGCAACAAATGGAA
CAGAAAGGTGTTTTACCAAATGTTGTCACATTCTCTTCTGTAATTAATGGTTATGCCAAAAGTGGAATGGTTGAGGCAGCTATTGAAATT
ATGAGGAAAATGGTAAGCATAAATGTTAACCCTAATGTTTTCACATATAATACCCTGATTGATGGCTGCTTTAAGGCTGGTAAACATGAT
ATGGCTCTTGCTCTGTATGXX\
Edits in Original Sequence 
GTTACTTATAATTCCCTTATATATGGTCTTTGTAAAA(5')ATGAACGGTTTCATGAGGCCAAATTACTTCTXTGATGAGATGAGAAGAG
TGGGTGTGGATCCTAATCACGTGACATACTCTATTTTTATTCATCACTTGTACAAAAATAAGGCCGAAAAGGTTGCTGCTAACTTCCAAA
GTCAAATAGTGATTAGAGGAGTGCCTTTCGATGTTGTCTTGTTTACCTCTTTGATAAATGGGCTTTTTAAAATTGGAAAATCCAGGGAGG
CAAAAGACGTGTTTCAGACACTCTTGAAGTCTAACATAACTCCAAATCATATTACCTATACTGCATTGGTTGATGGGCACTGCAAATCTG
GTGACTTAAAGAGTGTAGAGATTTTACTGCAACAAATGGAACAGAAAGGTGTTTTACCAAATGTTGTCACATTCTCTTCTGTAATTAATG
GTTATGCCAAAAGTGGAATGGTTGAGGCAGCTATTGAAATTATGAGGAAAATGGTAAGCATAAATGTTAACCCTAATGTTTTCACATATA
ATACCCTGATTGATGGCTGCTTTAAGGCTGGTAAACATGATATGGCTCTTGCTCTGTATGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan