Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U284476

Score 
459
Direction 
Reverse
Predicted Peptide Sequence 
MTPLLYNITFSCHTDKRGWQRRAVEVRVYSMEDISSHYCINSGILPSLGGHSDSKIRLRNYIISPINPRYKVWDAFLVLLVFYTAWASPF
QIGFLETPQGLIAILDNIVNFFFAIDIILSLFFVAYLDKSTYIMIDDPKRIALRYIKYGFIFDFISTIPYEALPRILQSYGFLSMLRLWR
LRRVSAMFVELEKNNKLSYFGIRVLKLVCVTLFAVHSAGCFYYFL
Predicted Coding Sequence 
ATGACTCCTCTTCTATATAACATAACGTTTAGTTGTCACACAGACAAAAGAGGGTGGCAGAGGCGGGCXGTCGAGGTTCGAGTGTATTCA
ATGGAGGATATAAGCTCTCATTATTGTATTAACAGTGGTATTCTTCCTTCTCTTGGCGGCCATAGTGATAGCAAAATTAGGCTCCGTAAC
TACATCATCTCCCCTATTAATCCCCGTTACAAGGTTTGGGACGCATTTTTGGTGCTTCTTGTTTTCTACACAGCATGGGCATCACCTTTT
CAGATTGGATTTCTAGAAACACCTCAAGGACTTATTGCCATCTTAGATAACATAGTCAACTTCTTTTTTGCCATTGACATTATCCTCTCA
TTGTTCTTTGTTGCATATCTTGATAAATCAACTTACATTATGATTGATGACCCAAAGCGCATTGCTTTGAGGTATATAAAATATGGATTT
ATCTTTGATTTCATATCCACTATCCCTTACGAAGCATTGCCTCGTATTCTTCAATCATATGGATTCTTGAGTATGCTTCGTCTCTGGCGT
CTCAGAAGAGTCAGTGCCATGTTTGTCGAATTGGAGAAAAACAATAAGTTGAGTTACTTTGGGATTCGAGTACTCAAGCTTGTATGTGTC
ACTCTTTTTGCTGTTCATTCTGCTGGCTGCTTCTACTACTTTCTX\
Edits in Original Sequence 
CGGGCCCCCCCTTTTTTTTTTATATTCTTCTTGACATTTAAATATTAAATAGTCTCTCATCTAAAAAGTGTAAGTAGAATATAATAAGGA
AAGGAAAGACGTGTTATGCCTTCAACAAGTAGTCCTAATCCTTTTCCCATAAGAATA
(5')ATGACTCCTCTTCTATATAACATAACGTT
TAGTTGTCACACAGACAAAAGAGGGTGGCAGAGGCGGGCXGTCGAGGTTCGAGTGTATTCAATGGAGGATATAAGCTCTCATTATTGTAT
TAACAGTGGTATTCTTCCTTCTCTTGGCGGCCATAGTGATAGCAAAATTAGGCTCCGTAACTACATCATCTCCCCTATTAATCCCCGTTA
CAAGGTTTGGGACGCATTTTTGGTGCTTCTTGTTTTCTACACAGCATGGGCATCACCTTTTCAGATTGGATTTCTAGAAACACCTCAAGG
ACTTATTGCCATCTTAGATAACATAGTCAACTTCTTTTTTGCCATTGACATTATCCTCTCATTGTTCTTTGTTGCATATCTTGATAAATC
AACTTACATTATGATTGATGACCCAAAGCGCATTGCTTTGAGGTATATAAAATATGGATTTATCTTTGATTTCATATCCACTATCCCTTA
CGAAGCATTGCCTCGTATTCTTCAATCATATGGATTCTTGAGTATGCTTCGTCTCTGGCGTCTCAGAAGAGTCAGTGCCATGTTTGTCGA
ATTGGAGAAAAACAATAAGTTGAGTTACTTTGGGATTCGAGTACTCAAGCTTGTATGTGTCACTCTTTTTGCTGTTCATTCTGCTGGCTG
CTTCTACTACTTTCTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan