Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U284477

Score 
331
Direction 
Forward
Predicted Peptide Sequence 
GIITDDEIVLSAVGKVFGRRSGDGLLWHTDLKPHASGDFSMAVVQANSSLEDQSQVLTSPSATYVGVYDGHGGPEAARFVNRHLFPYLNK
FQKEQGCLSSEVIKRAFNATEEDFIRLVKQSLPSMPKIASVGSCCLFGAISGSELYVANLGDSRAVLGRRGFDGERSKVVAERLSTDHNG
SX
Predicted Coding Sequence 
GGAATAATTACAGATGATGAGATTGTGTTATCGGCCGTTGGAAAGGTTTTTGGAAGGCGGAGTGGTGATGGACTTTTGTGGCATACGGAT
TTGAAGCCTCATGCATCTGGTGACTTTTCTATGGCTGTTGTTCAGGCTAATTCATCTCTTGAAGATCAAAGTCAAGTACTTACTTCTCCT
TCTGCTACCTATGTTGGTGTTTATGATGGTCATGGAGGTCCTGAAGCTGCGCGTTTTGTTAATAGACATCTCTTTCCTTATTTAAACAAG
TTTCAGAAAGAGCAAGGGTGTTTATCATCAGAGGTGATAAAGAGAGCATTTAATGCAACAGAAGAGGATTTTATTCGATTGGTGAAGCAA
TCATTGCCTTCAATGCCAAAGATTGCTTCAGTTGGATCATGTTGTTTGTTTGGTGCTATTTCGGGAAGTGAATTATATGTAGCTAATTTA
GGAGACTCGAGGGCAGTTCTTGGACGCAGAGGTTTTGACGGGGAGAGAAGTAAAGTGGTTGCAGAAAGATTGTCCACTGATCATAATGGT
TCATXX\
Edits in Original Sequence 
GTGTTTGTCTTTTTCAATACGCGCTTTTCCCCCCTTGACTCTCTCCCAACTCTTTTAACTAAAATCCCTCTCTTCTTCCACTTTTTTTTC
CCCCTATTTTCTTCCTTCTCCTATCTTCTTCTCTCTCTCTCACACACACACACACACAAAAGTTTGGGATTCAGATTGTAATTGAAC
(5')
GGAATAATTACAGATGATGAGATTGTGTTATCGGCCGTTGGAAAGGTgTTTTGGAAGGCGGAGTGGTGATGGACTTTTGTGGCATACGG
ATTTGAAGCCTCATGCATCTGGTGACTTTTCTATGGCTGTTGTTCAGGCTAATTCATCTCTTGAAGATCAAAGTCAAGTACTTACTTCTC
CTTCTGCTACCTATGTTGGTGTTTATGATGGTCATGGAGGTCCTGAAGCTGCGCGTTTTGTTAATAGACATCTCTTTCCTTATTTAAACA
AGTTTCAGAAAGAGCAAGGGTGTTTATCATCAGAGGTGATAAAGAGAGCATTTAATGCAACAGAAGAGGATTTTATTCGATTGGTGAAGC
AATCATTGCCTTCAATGCCAAAGATTGCTTCAGTTGGATCATGTTGTTTGTTTGGTGCTATTTCGGGAAGTGAATTATATGTAGCTAATT
TAGGAGACTCGAGGGCAGTTCTTGGACGCAGAGGTTTTGACGGGGAGAGAAGTAAAGTGGTTGCAGAAAGATTGTCCACTGATCATAATG
GTTCATXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan