ESTScan Details for Unigene SGN-U284509

Score 
930
Direction 
Forward
Predicted Peptide Sequence 
ELKAGCEIVVATPGRLIDMIRKKAFTMLRATYLVLDEADRMFDLGFEPQIRSIVGQIRPDRQTLLFSATMPRKVEKLAREILTDPVRVTV
GEIGTANEDITQIVEVIPSDAEKLPWLLEKLPGLIDNGDVLVFASKKATVDEIESQLAQKGFRVAALHGDKDQVSRTETLQKFKSGIYHV
LIATDVAARGLDIKSLKSVVNYDIAKDMDMHVHRIGRTGRAGDKDGTAYTLITHKEARFAGELANSLVAAGQTVSVELMDLAMKDGRFRS
KRDAKKGGGKRAKGRGGGNNKXVRGVDFGLGX
Predicted Coding Sequence 
GAACTAAAGGCAGGGTGTGAGATTGTTGTTGCTACTCCAGGGAGGTTGATAGATATGATCAGAAAGAAGGCATTTACAATGTTGAGAGCA
ACTTATCTAGTGCTTGATGAGGCTGATCGGATGTTTGACCTTGGTTTCGAGCCTCAGATAAGGTCCATTGTTGGTCAAATTAGACCTGAT
CGCCAAACATTGCTCTTTTCAGCAACTATGCCCCGCAAAGTTGAGAAGCTTGCCAGAGAAATATTGACGGATCCTGTAAGAGTTACTGTG
GGTGAGATTGGCACGGCTAATGAGGATATTACACAAATAGTTGAAGTGATTCCTTCGGATGCTGAAAAATTGCCTTGGCTTCTGGAGAAG
CTCCCTGGACTGATTGACAATGGTGATGTTCTTGTCTTTGCTTCGAAAAAGGCAACAGTGGATGAGATTGAATCCCAATTGGCTCAGAAG
GGATTTAGAGTTGCAGCTCTCCATGGTGACAAGGATCAAGTTTCTCGTACGGAGACGCTGCAAAAATTTAAATCTGGCATATATCATGTT
CTCATCGCAACTGATGTTGCTGCTCGTGGTCTTGACATCAAATCACTTAAGTCAGTGGTGAACTATGATATAGCTAAAGATATGGACATG
CATGTTCACAGAATTGGGAGAACAGGTCGTGCTGGTGACAAAGATGGAACGGCCTACACTCTTATTACTCATAAGGAAGCACGTTTTGCT
GGTGAACTGGCGAACAGTTTGGTTGCTGCTGGTCAAACTGTGTCCGTGGAACTAATGGACCTTGCTATGAAGGACGGAAGGTTTCGGTCC
AAAAGGGATGCAAAGAAAGGAGGTGGAAAAAGGGCCAAAGGAAGGGGAGGAGGAAACAATAAANGTGTACGAGGTGTGGATTTTGGTCTA
GGGATX\
Edits in Original Sequence 
(5')GAACTAAAGGCAGGGTGTGAGATTGTTGTTGCTACTCCAGGGAGGTTGATAGATATGATCAGAAAGAAGGCATTTACAATGTTGAG
AGCAACTTATCTAGTGCTTGATGAGGCTGATCGGATGTTTGACCTTGGTTTCGAGCCTCAGATAAGGTCCATTGTTGGTCAAATTAGACC
TGATCGCCAAACATTGCTCTTTTCAGCAACTATGCCCCGCAAAGTTGAGAAGCTTGCCAGAGAAATATTGACGGATCCTGTAAGAGTTAC
TGTGGGTGAGATTGGCACGGCTAATGAGGATATTACACAAATAGTTGAAGTGATTCCTTCGGATGCTGAAAAATTGCCTTGGCTTCTGGA
GAAGCTCCCTGGACTGATTGACAATGGTGATGTTCTTGTCTTTGCTTCGAAAAAGGCAACAGTGGATGAGATTGAATCCCAATTGGCTCA
GAAGGGATTTAGAGTTGCAGCTCTCCATGGTGACAAGGATCAAGTTTCTCGTACGGAGACGCTGCAAAAATTTAAATCTGGCATATATCA
TGTTCTCATCGCAACTGATGTTGCTGCTCGTGGTCTTGACATCAAATCACTTAAGTCAGTGGTGAACTATGATATAGCTAAAGATATGGA
CATGCATGTTCACAGAATTGGGAGAACAGGTCGTGCTGGTGACAAAGATGGAACGGCCTACACTCTTATTACTCATAAGGAAGCACGTTT
TGCTGGTGAACTGGCGAACAGTTTGGTTGCTGCTGGTCAAACTGTGTCCGTGGAACTAATGGACCTTGCTATGAAGGACGGAAGGTTTCG
GTCCAAAAGGGATGCAAAGAAAGGAGGTGGAAAAAGGGCCAAAGGAAGGGGAGGAGGAAACAATAAANGTGTACGAGGTGTGGATTTTGG
TCTAGGGATX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan