ESTScan Details for Unigene SGN-U284619

Score 
498
Direction 
Reverse
Predicted Peptide Sequence 
IVVATYEGEHNHPQTSKPELGASTNTSTASRLNVTTIAGTTTSVPCSTTLNSSGPTITLDLTAPKTVEKRDMKMNHSTTSPTGGNSIRTT
TSSTTTTGGEYQNRPEFQQFLIEQMATSLTKDPSFKAALAAAISGKILQHNNQXREMVNKSPAEQSTTLYRQLFNIFQLDSYEKFLEEKG
NTNYCSNVNTGRVGNIWTXKVGLGSARENGILLDREKFSTAAILGPLQNGLALSWLD
Predicted Coding Sequence 
XCTATTGTGGTAGCAACATATGAAGGAGAACATAACCATCCACAAACCTCAAAACCAGAATTAGGTGCAAGTACTAATACTTCCACTGCC
AGCCGATTAAATGTGACAACTATCGCGGGTACTACTACTTCAGTACCTTGTTCTACAACTCTCAATTCCTCAGGACCAACCATTACTCTC
GATCTTACTGCACCGAAAACAGTAGAAAAACGCGATATGAAGATGAATCACAGTACTACTAGTCCTACCGGAGGCAATAGCATTAGAACA
ACAACATCATCAACAACAACAACAGGAGGTGAATATCAAAATAGGCCAGAGTTTCAACAATTCTTGATAGAGCAAATGGCTACTTCATTG
ACCAAAGATCCAAGTTTCAAAGCAGCACTTGCAGCCGCCATATCAGGAAAAATCCTCCAACATAACAATCAGXACAGGGAGATGGTAAAC
AAAAGTCCAGCAGAGCAGTCAACTACTTTGTATAGACAATTGTTCAATATTTTCCAACTTGACTCATATGAAAAGTTCTTGGAGGAAAAA
GGAAACACAAATTATTGTTCAAATGTAAATACAGGAAGAGTTGGTAACATTTGGACCGXCAAAGTTGGACTTGGAAGTGCACGTGAGAAT
GGGATCTTGCTGGACCGTGAGAAATTTTCAACAGCGGCCATATTGGGTCCCCTGCAGAATGGACTTGCTCTGAGTTGGCTAGATTGA\
Edits in Original Sequence 
(5')XCTATTGTGGTAGCAACATATGAAGGAGAACATAACCATCCACAAACCTCAAAACCAGAATTAGGTGCAAGTACTAATACTTCCAC
TGCCAGCCGATTAAATGTGACAACTATCGCGGGTACTACTACTTCAGTACCTTGTTCTACAACTCTCAATTCCTCAGGACCAACCATTAC
TCTCGATCTTACTGCACCGAAAACAGTAGAAAAACGCGATATGAAGATGAATCACAGTACTACTAGTCCTACCGGAGGCAATAGCATTAG
AACAACAACATCATCAACAACAACAACAGGAGGTGAATATCAAAATAGGCCAGAGTTTCAACAATTCTTGATAGAGCAAATGGCTACTTC
ATTGACCAAAGATCCAAGTTTCAAAGCAGCACTTGCAGCCGCCATATCAGGAAAAATCCTCCAACATAACAATCAGXACAGGGAGATGGT
AAACAAAAGTCCAGCAGAGCAGTCAACTACTTTGTATAGACAATTGTTCAATATTTTCCAACTTGACTCATATGAAAAGTTCTTaGGAGG
AAAAAGGAAACACAAATTATTGTTCAAATGTAAATACAGGAAGAGTTGGTAACATTTGGACCGXCAAAGTTGGACTTGGAAGTGCACGTG
AGAATGGGATCTTGCTGGACCGTGAGAAATTTTCAACAGCGGCCATATTGGGTCCCCTGCAGAATGGACTTGCTCTGAGTTGGCTAGATT
GA\(3')GACTGAATTGTGTCCTTGAAACATTTAAGTTGTTGAATTTGACAACTTTGTAGAATACTGAAATGAGATTATGAAATATACAA
CTTATTGTTCTGTTCAAAAAAAAAAAAAAAAAAAACTCGAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan