ESTScan Details for Unigene SGN-U284640

Score 
187
Direction 
Forward
Predicted Peptide Sequence 
DXPAYFAKESYPGTANSVSFHNIHDDKLCATVYLVFGQKKAWVLVPVATMACLPITSFVLLQFPLLVALISSTYGAGIFGKKSNLLF
Predicted Coding Sequence 
GATXTTCCTGCATACTTTGCCAAGGAGTCTTATCCTGGGACTGCTAACTCTGTTTCTTTCCATAACATCCATGATGATAAGCTTTGTGCA
ACGGTGTATCTCGTGTTTGGGCAGAAGAAAGCATGGGTTCTTGTACCAGTTGCAACAATGGCTTGCCTACCGATTACTTCATTTGTGCTT
CTGCAATTTCCCCTCCTTGTTGCTCTCATTTCCTCAACATATGGGGCTGGCATTTTTGGAAAGAAGAGTAACCTCTTGTTTTAG\
Edits in Original Sequence 
(5')GATXTTCCTGCATACTTTGCCAAGGAGTCTTATCCTGGGACTGCTAACTCTGTTTCTTTCCATAACATCCATGATGATAAGCTTTa
GTGCAACGGTGTATCTCGTGTTTGGGCAGAAGAAAGCATGGGTTCTTGTACCAGTTGCAACAATGGCTTGCCTACCGATTACTTCATTTG
TGCTTCTGCAATTTCCCCTCCTTGTTGCTCTCATTTCCTCAACATATGGGGCTGGCATTTTTGGAAAGAAGAGTAACCTCTTGTTTTAG\
(3')TGATGAATTTTGTTATTGTTATTATTATCTATATTTATATTACTTTAAAAACACGAAGGTCCTTAGAATTTCAACATTTAACTTTG
TATCCTTTGCTGAAAGACTATAACAGATACAATTTTCATTTAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan