ESTScan Details for Unigene SGN-U284689

Score 
850
Direction 
Forward
Predicted Peptide Sequence 
EDLQDRGRTKKDEPAVIQLQEYLKHSGSLTRQSFKNRGLVLPFQPLSMTFKDINYYVDIPLELKQQGMAEDRLQLLVNITGAFSPGVLTA
LVGVSGAGKTTLMDVLAGRKTGGTIEGSIHISGYPKKQETFARISGYCEQNDIHSPCLTILESLLFSAWLRLPSEVDLETQKAFVDEVME
LVELSPLRGALVGLPGVDGLSTEQRKRLTIAVELVANPSIVFMDEPTSGLDARAAAIVMRTVRNIVNTGRTIVCTIHQPSIDIFESFDEL
LFMKRGGELIYAGPLGPKSCKLIEYFEAIEGLPQNXDLGYNPATWMLEVTSSVEENRLGVDFAEIYQRSNLFQYEQFSHL
Predicted Coding Sequence 
GAAGATCTTCAAGACAGAGGCAGGACTAAGAAAGATGAACCTGCTGTCATTCAGCTACAAGAGTATTTAAAGCATTCTGGCTCGCTGACT
AGACAAAGTTTCAAGAACAGGGGCCTCGTTCTACCTTTTCAGCCACTTTCCATGACTTTCAAGGATATCAACTACTATGTCGACATACCT
CTGGAACTGAAACAACAAGGCATGGCAGAAGACCGGTTGCAGTTGTTGGTTAACATCACTGGAGCATTTAGTCCTGGGGTTCTGACTGCA
CTGGTGGGAGTTAGTGGTGCTGGAAAAACCACCCTCATGGATGTATTAGCCGGTAGAAAAACTGGTGGTACTATAGAAGGGAGCATACAC
ATATCGGGTTACCCAAAGAAGCAAGAAACGTTTGCTAGAATATCTGGCTACTGTGAGCAAAATGACATCCACTCACCTTGCTTGACCATT
CTTGAATCACTATTGTTCTCTGCTTGGCTACGTTTGCCATCAGAGGTTGACCTAGAGACACAAAAGGCATTTGTTGACGAGGTAATGGAG
CTTGTGGAGCTGAGTCCACTAAGAGGAGCTTTGGTTGGTTTGCCTGGAGTTGATGGACTGTCAACAGAGCAAAGGAAGCGGCTAACAATT
GCTGTTGAACTAGTAGCGAACCCTTCTATAGTGTTCATGGATGAACCTACATCTGGATTGGATGCAAGAGCTGCAGCTATTGTAATGAGG
ACTGTACGTAACATTGTGAACACCGGCCGAACAATTGTTTGCACTATCCATCAGCCCAGCATTGACATTTTTGAATCATTTGATGAGCTT
TTGTTTATGAAGCGTGGAGGAGAGCTCATTTATGCAGGACCTCTTGGTCCTAAATCTTGCAAGTTAATTGAGTATTTTGAGGCAATTGAA
GGGTTACCCCAAAATAXAGACCTNGGATATAACCCAGCTACATGGATGTTGGAGGTTACTTCGTCAGTAGAAGAAAATCGACTTGGTGTT
GATTTTGCAGAAATTTACCAAAGATCAAACCTTTTTCAGTACGAACAGTTTTCTCATCTCTAA\
Edits in Original Sequence 
(5')GAAGATCTTCAAGACAGAGGCAGGACTAAGAAAGATGAACCTGCTGTCATTCAGCTACAAGAGTATTTAAAGCATTCTGGCTCGCT
GACTAGACAAAGTTTCAAGAACAGGGGCCTCGTTCTACCTTTTCAGCCACTTTCCATGACTTTCAAGGATATCAACTACTATGTCGACAT
ACCTCTGGAACTGAAACAACAAGGCATGGCAGAAGACCGGTTGCAGTTGTTGGTTAACATCACTGGAGCATTTAGTCCTGGGGTTCTGAC
TGCACTGGTGGGAGTTAGTGGTGCTGGAAAAACCACCCTCATGGATGTATTAGCCGGTAGAAAAACTGGTGGTACTATAGAAGGGAGCAT
ACACATATCGGGTTACCCAAAGAAGCAAGAAACGTTTGCTAGAATATCTGGCTACTGTGAGCAAAATGACATCCACTCACCTTGCTTGAC
CATTCTTGAATCACTATTGTTCTCTGCTTGGCTACGTTTGCCATCAGAGGTTGACCTAGAGACACAAAAGGCATTTGTTGACGAGGTAAT
GGAGCTTGTGGAGCTGAGTCCACTAAGAGGAGCTTTGGTTGGTTTGCCTGGAGTTGATGGACTGTCAACAGAGCAAAGGAAGCGGCTAAC
AATTGCTGTTGAACTAGTAGCGAACCCTTCTATAGTGTTCATGGATGAACCTACATCTGGATTGGATGCAAGAGCTGCAGCTATTGTAAT
GAGGACTGTACGTAACATTGTGAACACCGGCCGAACAATTGTTTGCACTATCCATCAGCCCAGCATTGACATTTTTGAATCATTTGATGA
GCTTTTGTTTATGAAGCGTGGAGGAGAGCTCATTTATGCAGGACCTCTTGGTCCTAAATCTTGCAAGTTAATTGAGTATTTTGAGGCAAT
TGAAGGGTTACCCCAAAATAXAGACCTNGGATATAACCCAGCTACATGGATGTTGGAGGTTACTTCGTCAGTAGAAGAAAATCGACTTGG
TGTTGATTTTGCAGAAATTTACCAAAGATCAAACCTTTTTCAGTACGAACAGTTTTCTCATCTCTAA\(3')CTTTCTCTATGCTCTTTT
TCTTAACTCTTTACTTCTTTTCTTGTTGTTTCCAGATATAATCCAAGTCTTGGGTTGAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan