ESTScan Details for Unigene SGN-U284736

Score 
56
Direction 
Reverse
Predicted Peptide Sequence 
RTPDLNLLRCVNIQEAETIMNEVHSGVCGSHMNGYVXSKKDYLGRVLLVDHGAEIASDLYAGAISARFIALDSLTPFRVAPYVYSVAFCG
LGNGRYWADEPKASNGHRFILVAIDYFTKWVEAVTFKSVTKKAVVDFVHSNIICRFGIPKIIITDNAANLNSHLMKEVCEQFKIVHVIQP
LIDPKKMGLLKRQIKTSRRFLGEWCKDLDSGMKNYSLLTWDTXTTIRTLVCATPYLLVYGTEVVIPAEVX
Predicted Coding Sequence 
XXAAGGACTCCAGATTTGAATCTATTACGATGTGTGAATATTCAAGAAGCAGAAACAATTATGAATGAGGTGCATTCAGGGGTTTGTGGA
TCTCACATGAATGGTTATGTTXCTAGCAAAAAAGATTATCTAGGCAGGGTACTATTGGTTGACCATGGAGCXGAGATTGCTTCTGATTTG
TACGCAGGTGCCATCAGTGCCAGATTCATAGCACTTGATTCACTCACCCCCTTTAGAGTTGCACCCTATGTCTACTCCGTGGCCTTTTGT
GGCTTGGGGAATGGACGTTATTGGGCCGATGAACCGAAAGCATCTAATGGGCATCGGTTTATTTTAGTTGCCATCGACTACTTTACCAAA
TGGGTGGAAGCTGTCACATTCAAATCAGTCACCAAGAAAGCAGTGGTGGACTTTGTTCATTCAAACATCATATGTCGTTTCGGCATACCA
AAAATCATTATTACAGACAATGCAGCGAATCTCAACAGCCACCTGATGAAGGAAGTTTGTGAGCAATTTAAAATTGTTCACGTCATTCAA
CCCCTTATCGACCCAAAGAAAATGGGGCTGTTGAAGCGGCAAATAAAAACATCAAGAAGATTCTTAGGAGAATGGTGCAAAGATCTAGAC
AGTGGCATGAAAAACTACTCTTTACTCACTTGGGATACCGXCACGACTATTCGTACGTTAGTCTGTGCAACTCCTTACTTATTGGTTTAC
GGAACCGAGGTTGTCATACCCGCAGAAGTTGXX\
Edits in Original Sequence 
(5')XXAAGGACTCCAGATTTGAATCTATTACGATGTGTGAATATTCAAGAAGCAGAAACAATTATGAATGAGGTGCATTCAGGGGTTTG
TGGATCTCACATGAATGGTTATGTTXCTAGCAAAAAAGATTATCTAGGCAGGGTACTATTGGTTGACCATGGAGCXGAGATTGCTTCTGA
TTTGTACGCAGGTGCCATCAGTGCCAGATTCATAGCgACTTGATTCACTCACCCCCTTTAGAGTTGCACCCTATGTCTACTCCGTGGCCT
TTTGTGGCTTGGGGAATGGACGTTATTGGGCCGAtTGAACCGAAAGCATCTAATGGGCATCGGTTTATTTTAGTTGCCATCGACTACTTT
ACCAAATGGGTGGAAGCTGTCACATTCAAATCAGTCACCAAGAAAGCAGTGGTGGACTTTGTTCATTCAAACATCATATGTCGTTTCGGC
ATACCAAAAATCATTATTACAGACAATGCAGCGAATCTCAACAGCCACCTGATGAAGGAAGTTTGTGAGCAATTTAAAATTGTTCACGTC
ATTCAACCCCTTATCGACCCAAAGAAAATGGGGCTGTTGAAGCGGCAAATAAAAACATCAAGAAGATTCTTAGGAGAATGGTGCAAAGAT
CTAGACAGTGGCATGAAAAACTACTCTTTACTCACTTGGGATACCGXCACGACTATTCGTACGTTAGTCTGTGCAACTCCTTACTTATTG
GTTTACGGAACCGAGGTTGTCATACCCGCAGAAGTTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan