ESTScan Details for Unigene SGN-U284822

Score 
183
Direction 
Reverse
Predicted Peptide Sequence 
MLLDRGVNPDILNRHKQTPLMLAAMHGNVSCVERLIQLGANILMFDSLHGRTCLHYAAYHGHSDCLQSILASAHSAPVAQSWGFARFVNI
RDGSGATPLHLAARHGRPACVRILLSNEALVCASSGGYGRPGSTPLHLAAREGSLDCIRELLAWGADRLYRDSSGRIPYIVALKKQHEAC
AA
Predicted Coding Sequence 
ATGCTTTTGGATCGTGGGGTTAATCCAGACATCTTGAATCGCCACAAACAGACTCCATTAATGTTAGCTGCTATGCATGGAAATGTGTCC
TGCGTGGAGAGGCTAATTCAGCTAGGTGCTAATATTTTAATGTTTGATTCACTTCATGGAAGAACTTGTCTGCATTATGCTGCTTACCAT
GGCCACTCTGACTGCCTACAATCGATCCTTGCATCCGCTCATTCGGCTCCTGTTGCTCAATCTTGGGGATTTGCGAGATTCGTGAACATA
AGAGATGGGAGTGGTGCAACCCCATTGCATTTAGCAGCCCGTCATGGTAGACCAGCATGTGTCCGGATTCTTCTAAGCAATGAGGCTCTT
GTCTGTGCTTCTAGTGGTGGCTATGGCCGTCCAGGAAGTACACCACTGCATTTAGCAGCTCGAGAAGGTTCTTTGGACTGTATACGTGAG
TTACTTGCTTGGGGTGCAGATCGACTTTATAGAGATTCTTCTGGGCGAATTCCATACATAGTTGCTTTGAAGAAACAGCATGAAGCATGC
GCTGCX\
Edits in Original Sequence 
GTAACCTTAAAGTGGGAGGTGGACGTGGAGGGTGTTTATTGTTCGAGCAACCCTTTTGTCAGGAAAAAAAATGTAGTCTTTACAGTCTTG
TTTTTCCCTTGTTTTTGTTTGTAATGATTGTTGATCTTTGATGAGTGATTTTGGATAGGTTCTGTGT
(5')ATGCTTTTGGATCGTGGGG
TTAATCCAGACATCTTGAATCGCCACAAACAGACTCCATTAATGTTAGCTGCTATGCATGGAAATGTGTCCTGCGTGGAGAGGCTAATTC
AGCTAGGTGCTAATATTTTAATGTTTGATTCACTTCATGGAAGAACTTGTCTGCATTATGCTGCTTACCATGGCCACTCTGACTGCCTAC
AATCGATCCTTGCATCCGCTCATTCGGCTCCTGTTGCTCAATCTTGGGGATTTGCGAGATTCGTGAACATAAGAGATGGGAGTGGTGCAA
CCCCATTGCATTTAGCAGCCCGTCATGGTAGACCAGCATGTGTCCGGATTCTTCTAAGCAATGAGGCTCTTGTCTGTGCTTCTAGTGGTG
GCTATGGCCGTCCAGGAAGTACACCACTGCATTTAGCAGCTCGAGAAGGTTCTTTGGACTGTATACGTGAGTTACTTGCTTGGGGTGCAG
ATCGACTTTATAGAGATTCTTCTGGGCGAATTCCATACATAGTTGCTTTGAAGAAACAGCATGAAGCATGCGCTGCX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan