ESTScan Details for Unigene SGN-U284869

Score 
280
Direction 
Forward
Predicted Peptide Sequence 
NEKDVQSFVASCQICQQMKDVHHHPAGLLQPLPIPDLVFEDIAMDFITCLPSSKGKSTILTVVDRLTKYGHFIPLSASFSTRIVAEAFVV
GIIRLHGPPRTIVTDRDPRFLHSFWQEVNRLQGTSLAMSTAYHPQSDGQSEALNKCVEQYLRCYVADAPHCWVAMLPWAEYWYTRRIRPP
AGMSPFKALYGREPPTIARYVSGSSPSELVEEYFVDRDKVLSLLKINLLKAQGRNEKFADXHXTELELX
Predicted Coding Sequence 
AATGAGAAAGATGTCCAGAGTTTTGTTGCATCCTGTCAAATTTGCCAGCAAATGAAAGATGTGCACCACCATCCAGCAGGTCTATTGCAA
CCATTGCCCATTCCAGATCTGGTATTTGAAGATATAGCTATGGATTTTATCACGTGTTTGCCTAGTTCGAAAGGCAAGTCTACTATCTTA
ACTGTGGTAGACCGGTTGACAAAATACGGTCATTTCATTCCTTTATCTGCCTCATTTTCCACTCGAATTGTTGCTGAAGCTTTTGTGGTT
GGGATTATTCGCCTTCATGGTCCTCCACGAACCATTGTCACTGATCGTGACCCCAGGTTTCTACATTCTTTTTGGCAAGAAGTCAACCGA
TTACAAGGGACGTCTTTGGCTATGAGTACAGCGTACCACCCCCAGTCTGACGGTCAATCAGAGGCTCTGAACAAGTGTGTTGAGCAGTAT
CTTCGTTGTTATGTTGCTGATGCACCACATTGTTGGGTTGCAATGTTGCCATGGGCTGAATATTGGTACACACGGCGTATCAGACCTCCX
GCTGGCATGTCCCCATTTAAGGCCCTTTACGGAAGAGAACCTCCCACCATAGCACGTTATGTGTCAGGCAGCAGTCCTAGCGAGCTAGTG
GAGGAGTATTTCGTTGATCGTGATAAGGTTTTGAGCCTTTTAAAGATCAATTTGCTTAAGGCACAGGGGCGAAATGAAAAGTTTGCTGAC
NAACATCNGACTGAGCTTGAATTGAXX\
Edits in Original Sequence 
(5')AATGAGAAAcGATGTCCAGAGTTTTGTTGCATCCTGTCAAATTTGCCAGCAAATGAAAGATGTGCACCACCATCCAGCAGGTCTAT
TGCAACCATTGCCCATTCCAGATCTGGTATTTGAAGATATAGCTATGGATTTTATCACGTGTTTGCCTAGTTCGAAAGGCAAGTCTACTA
TCTTAACTGTGGTAGACCGGTTGACAAAATACGGTCATTTCATTCCTTTATCTGCCTCATTTTCCACTCGAATTGTTGCTGAAGCTTTTG
TGGTTGGGATTATTCGCCTTCATGGTCCTCCACGAACCATTGTCACTGATCGTGACCCCAGGTTTCTACATTCTTTTTGGCAAGAAGTCA
ACCGATTACAAGGGACGTCTTTGGCTATGAGTACAGCGTACCACCCCCAGTCTGACGGTCAATCAGAGGCTCTGAACAAGTGTGTTGAGC
AGTATCTTCGTTGTTATGTTGCTGATGCACCACATTGTTGGGTTGCAATGTTGCCATGGGCTGAATATTGGTACACACGGCGTATCAGAC
CTCCXGCTGGCATGTCCCCATTTAAGGCCCTTTACGGAAGAGAACCTCCCACCATAGCACGTTATGTGTCAGGCAGCAGTCCTAGCGAGC
TAGTGGAGGAGTATTTCGTTGATCGTGATAAGGTTTTGAGCCTTTTAAAGATCAATTTGCTTAAGGCACAGGGGCGAAATGAAAAGTTTG
CTGACNAACATCNGACTGAGCTTGAATTGAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan