ESTScan Details for Unigene SGN-U284929

Score 
638
Direction 
Forward
Predicted Peptide Sequence 
RKPLPLRLLKSDTKQISNFMASATAPPAPFTFLSRNLSNNDHRTDARWLTTKQRRRRVGLQVYATEEGASGQQRAPPGVDTRIHWENEDE
GWVGESKSRSTQERIKTDKKNLLDEKFSDLLNSSANSHYQFLGVSATADLEEIKAAYRRLSKEYHPDTTNLPIRAASEKFMKLREIYDVL
SDEEQRRFYDWTLAQETASREAEKMKMRLQX
Predicted Coding Sequence 
XXGAGAAAGCCCCTCCCTCTAAGACTACTCAAATCAGACACAAAACAAATTTCCAATTTCATGGCCTCAGCAACAGCTCCACCAGCTCCA
TTCACCTTCCTTTCAAGGAACCTAAGCAATAATGATCACAGAACAGATGCCAGATGGTTGACAACAAAACAAAGAAGACGCCGTGTTGGC
TTACAAGTTTATGCAACAGAAGAAGGGGCTAGTGGGCAACAACGTGCTCCTCCTGGTGTTGACACAAGAATTCACTGGGAAAACGAAGAT
GAAGGATGGGTAGGAGAGAGTAAATCACGGTCCACACAAGAACGAATCAAAACAGACAAAAAGAATCTCCTTGATGAGAAATTCTCAGAC
CTCCTCAACAGTTCAGCTAATTCTCACTACCAGTTCTTGGGAGTATCTGCAACAGCTGATCTGGAGGAAATTAAAGCTGCATATAGGAGG
CTATCAAAGGAGTATCATCCAGACACAACTAACCTTCCTATAAGAGCAGCATCAGAGAAATTCATGAAACTAAGAGAAATTTATGATGTC
CTGAGTGATGAGGAACAACGTCGATTCTATGATTGGACACTAGCTCAGGAGACAGCAAGTCGAGAAGCAGAGAAAATGAAAATGAGGCTG
CAAGXX\
Edits in Original Sequence 
(5')XXGAGAAAGCCCCTCCCTCTAAGACTACTCAAATCAGACACAAAACAAATTTCCAATTTCATGGCCTCAGCAACAGCTCCACCAGC
TCCATTCACCTTCCTTTCAAGGAACCTAAGCAATAATGATCACAGAACAGATGCCAGATGGTTGACAACAAAACAAAGAAGACGCCGTGT
TGGCTTACAAGTTTATGCAACAGAAGAAGGGGCTAGTGGGCAACAACGTGCTCCTCCTGGTGTTGACACAAGAATTCACTGGGAAAACGA
AGATGAAGGATGGGTAGGAGAGAGTAAATCACGGTCCACACAAGAACGAATCAAAACAGACAAAAAGAATCTCCTTGATGAGAAATTCTC
AGACCTCCTCAACAGTTCAGCTAATTCTCACTACCAGTTCTTGGGAGTATCTGCAACAGCTGATCTGGAGGAAATTAAAGCTGCATATAG
GAGGCTATCAAAGGAGTATCATCCAGACACAACTAACCTTCCTATAAGAGCAGCATCAGAGAAATTCATGAAACTAAGAGAAATTTATGA
TGTCCTGAGTGATGAGGAACAACGTCGATTCTATGATTGGACACTAGCTCAGGAGACAGCAAGTCGAGAAGCAGAGAAAATGAAAATGAG
GCTGCAAGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan