ESTScan Details for Unigene SGN-U284962

Score 
243
Direction 
Forward
Predicted Peptide Sequence 
EEFRMGNEVRGLPCAHNFHVECIDEWLRLNVKCPRCRSSVFPNLDLSALSNIRTDSEGSTANVVTAAQYXEIPTLQPELSAKNARFAPPV
PTQDTGLGSEVDPADISNQASTPHSHGNVEPVQVVVEQSPRENNHTSRGGSLPFQISNLVIPNNLSHCPVFVVVSHCNQISSIGNVVAMI
YVHSQLVQMEQYMFVLPPVVSIIHILV
Predicted Coding Sequence 
GAAGAGTTTCGCATGGGAAATGAGGTTCGTGGTCTGCCTTGTGCTCACAACTTTCACGTGGAATGCATTGATGAATGGCTTCGCCTAAAC
GTGAAATGCCCTAGATGCCGCTCTTCTGTCTTTCCAAATCTTGATCTCAGTGCTTTATCCAATATCCGAACCGATTCAGAGGGGTCAACA
GCCAATGTTGTGACAGCAGCACAGTATGXTGAGATCCCAACCCTCCAGCCAGAGCTATCTGCTAAGAATGCAAGGTTTGCTCCGCCTGTA
CCCACACAGGATACTGGCCTGGGCAGTGAGGTAGATCCTGCTGATATCAGCAACCAAGCATCCACACCTCATAGTCATGGAAACGTGGAA
CCTGTACAAGTTGTAGTGGAACAGTCTCCGAGGGAGAATAACCATACTTCCAGAGGAGGTTCTTTACCTTTTCAAATTTCTAACTTGGTG
ATTCCTAACAACCTTAGTCATTGTCCAGTGTTCGTAGTGGTTTCTCATTGCAACCAAATTTCATCAATTGGAAATGTGGTGGCAATGATT
TATGTTCACAGCCAGCTTGTTCAGATGGAGCAATATATGTTTGTTTTACCACCAGTTGTATCGATTATTCACATACTGGTT\
Edits in Original Sequence 
(5')GAAGAGTTTCGCATGGGAAATGAGGTTCGTGGTCTGCCTTGTGCTCACAACTTTCACGTGGAATGCATTGATGAATGGCTTCGCCT
AAACGTGAAATGCCCTAGATGCCGCTCTTCTGTCTTTCCAAATCTTGATCTCAGTGCTTTATCCAATATCCGAACCGATTCAGAGGGGTC
AACAGCCAATGTTGTGACAGCAGCACAGTATGXTGAGATCCCAACCCTCCAGCCAGAGCTATCTGCTAAGAATGCAAGGTTTGCTCCGcC
CTGTACCCACACAGGATACTGGCCTGGGCAGTGAGGTAGATCCTGCTGATATCAGCAACCAAGCATCCACACCTCATAGTCATGGAAACG
TGGAACCTGTACAAGTTGTAGTGGAACAGTCTCCGAGGGAGcAATAACCATACTTCCAGAGGAGGTTCTTTACCTTTTCAAATTTCTAAC
TTGGTGATTCCTAACAACCTgTAGTCATTGTCCAGTGTTCGTAGTGGTTTCTCATTGCAACCAAATTTCATCAATTGGAAATGTGGTGGC
AATGATTTATGTTCACAGCCAGCTTGTTCAGATGGAGCAATATATGTTTGTTTTACCACCAGTTGTATCGATTATTCACATACTGGTT\
(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan