Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U285086

Score 
160
Direction 
Reverse
Predicted Peptide Sequence 
ALRGIXDAIWVIVDRLTKSAHFLAIKMDYSLECLAELYIKEIGRLHGIPVSIVSDGTQGLHLDFGVACRKLWXTKLKFSTSFHPQTNGQS
ERVIQILEDMLQACIMEFEGSWDKHLALIEFSYNNSYQSSIGMPPYEAYREENAGPLFVGVKLVNEXLVGPEIVQQTEDKVKIIKDCLKI
SSDRQKSYADLKRRDIEYQVGDKVFXKGVSMEKDYVIWPEKKTSPRFIGPYEILERVGPVAYKLALQPELDKIH
Predicted Coding Sequence 
XTTGCACTTAGAGGAATCAXTGATGCAATATGGGTGATTGTGGACAGGCTAACCAAGAGTGCTCATTTCTTAGCAATCAAGATGGATTAC
TCACTTGAGTGTTTAGCTGAGTTGTACATTAAGGAGATTGGAAGACTACATGGAATCCCTGTGTCTATTGTATCAGATGGAACCCAAGGT
TTACATCTAGATTTTGGGGTAGCTTGTAGGAAGCTTTGGGXTACTAAGTTGAAGTTTAGCACTTCGTTCCATCCTCAAACTAACGGCCAG
TCGGAAAGAGTGATACAAATTTTGGAGGATATGCTTCAAGCTTGCATTATGGAGTTTGAAGGTAGTTGGGACAAACACTTGGCCTTGATA
GAATTTTCTTACAATAACAGTTACCAATCGAGTATTGGAATGCCTCCCTATGAAGCTTATAGGGAAGAAAATGCCGGACCCCTCTTTGTT
GGAGTGAAGTTGGTGAATGAAAXTCTTGTTGGTCCTGAAATTGTGCAACAAACAGAGGACAAGGTAAAAATTATCAAAGATTGTCTAAAG
ATTTCTTCGGATAGACAAAAGTCGTATGCTGATCTTAAAAGGCGTGATATTGAATATCAAGTTGGGGATAAAGTATTCTTXAAGGGTGTC
TCCATGGAAAAAGATTATGTGATTTGGCCAGAAAAGAAAACTAGTCCCCGATTTATTGGACCTTATGAGATACTTGAAAGGGTTGGACCA
GTTGCATATAAATTGGCGTTGCAACCTGAGTTAGACAAGATCCAC\
Edits in Original Sequence 
(5')XTTGCACTTAGAGGAATCAXTGATGCAATATGGGTGATTGTGGACAGGCTAACCAAGAGTGCTCATTTCTTAGCAATCAAGATGGA
TTACTCACTTGAGTGTTTAGCTGAGTTGTACATTAAGGAGATTGGAAGACTACATGGAATCCCTGTGTCTATTGTATCAGATcGGAACCC
AAGGTTTACATCTAGATTTTGGGGTAGCTTGTAGGAAGCTTTGGGXTACTAAGTTGAAGTTTAGCACTTCGTTCCATCCTCAAACTAACG
GCCAGTCGGAAAGAGTGATACAAATTTTGGAGGATATGCTTCAAGCTTGCATTATGGAGTTTGAAGGTAGTTGGGACAAACACTTGGCCT
TGATAGAATTTTCTTACAATAACAGTTACCAATCGAGTATTGGAATGCCTCCCTATGAAGaCTTATAGGGAAGAAAATGCCGGACCCCTC
TTTGTTGGAGTGAAGTTGGTGAATGAAAXTCTTGTTGGTCCTGAAATTGTGCAACAAACAGAGGACAAGGTAAAAATTATCAAAGATTGT
CTAAAGATTTCTTCGGATAGACAAAAGTCGTATGCTGATCTTAAAAGGCGTGATATTGAATATCAAGTTGGGGATAAAGTATTCTTXAAG
GGTGTCTCCATGGAAAAAGATTATGTGATTTGGCCAGAAAAGAAAACgTAGTCCCCGATTTATTGGACCTTATGAGATACTTGAAAGGGT
TGGACCAGTTGCATATAAATTGGCGTTGCAACCTGAGTTAGACAAGATCCAC\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan