ESTScan Details for Unigene SGN-U285174

Score 
428
Direction 
Forward
Predicted Peptide Sequence 
MSGYSQTSPPYSSPQPPAPPPQQPTMSGYSQTSPPYSSPQPPYHFPGQGQPYSHPQPYPQHQQQPPPSHEYGQPAYPGWRGPYYNAPPQQ
PGAMLQPPYTAPSPYPHPPPHQSGYYRQ
Predicted Coding Sequence 
ATGTCGGGATATAGTCAAACTTCTCCTCCTTATAGTTCTCCACAACCGCCTGCACCTCCTCCTCAGCAACCAACAATGTCTGGATATAGT
CAAACCTCTCCTCCTTATAGTTCTCCACAACCGCCATACCATTTTCCAGGTCAAGGTCAACCATATTCGCATCCACAGCCCTATCCTCAA
CATCAACAACAACCTCCTCCTAGCCACGAGTACGGCCAACCTGCTTATCCTGGTTGGAGGGGTCCATACTATAATGCACCTCCACAGCAA
CCCGGAGCTATGCTTCAGCCTCCTTACACAGCCCCTTCCCCATATCCTCATCCTCCTCCCCATCAGAGTGGCTATTACAGGCAATGA\
Edits in Original Sequence 
ACA(5')ATGTCGGGATATAGTCAAACTTCTCCTCCTTATAGTTCTCCACAACCGCCTGCACCTCCTCCTCAGCAACCAACAATGTCTGG
ATATAGTCAAACCTCTCCTCCTTATAGTTCTCCACAACCGCCATACCATTTTCCAGGTCAAGGTCAACCATATTCGCATCCACAGCCCTA
TCCTCAACATCAACAACAACCTCCTCCTAGCCACGAGTACGGCCAACCTGCTTATCCTGGTTGGAGGGGTCCATACTATAATGCACCTCC
ACAGCAACCCGGAGCTATGCTTCAGCCTCCTTACACAGCCCCTTCCCCATATCCTCATCCTCCTCCCCATCAGAGTGGCTATTACAGGCA
ATGA\(3')TAGTTTTCCAATAACTTTCTCCGTGTGTATCTCATGTTCATTTTTTATCGTTCTCAAGTCGATTAGATCGGACGTAACGAG
ACTTCTTTGTCTGTACCAGATCTTAGCATACATTGTTATACATTTGTAAGTAAGTTTGAATGAAGCACACATGTACAGGGTATCTCCTTG
TAAAATTGATTACCTAAACTACAAGATCAATAATTTTGGAACTCTATAAGATCTGATATATCGTGAATGATTAAGAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan