ESTScan Details for Unigene SGN-U285319

Score 
85
Direction 
Forward
Predicted Peptide Sequence 
VAHLSISRSSLDLQNASSQRSRASYLISPHSLGYPSLSPLNSRYMSPYFPSPGNASSIILAPQVGIPTHCVIVSQPLAFRHLLQLSLFRD
VSRDXVGSGKSGFKFAATLLTKINEFGSSQITPKDNATALEMQLWHMGRQENDRKPW
Predicted Coding Sequence 
GTCGCTCATCTTAGTATAAGCCGCAGTTCACTTGACCTTCAGAATGCGTCTTCCCAGAGATCTCGTGCATCTTATTTGATTTCCCCTCAC
TCGTTGGGCTATCCTTCTCTATCTCCTCTTAATTCAAGATACATGTCACCATATTTTCCTAGTCCAGGAAATGCCTCGTCCATTATATTG
GCTCCTCAAGTCGGCATCCCAACCCACTGCGTCATAGTGAGTCAACCACTAGCTTTTCGCCATTTGCTTCAGCTCAGTCTCTTCCGGGAT
GTGAGTCGTGATGXTGTTGGTTCTGGAAAATCTGGGTTCAAGTTTGCXGCTACCCTTTTAACAAAGATCAATGAGTTTGGGTCATCTCAA
ATAACACCTAAAGACAATGCAACAGCTTTGGAGATGCAGCTCTGGCATATGGGCAGACAGGAAAATGACAGGAAGCCCTGG\
Edits in Original Sequence 
(5')GTCGCTCATCTTAGTATAAGCCGCAGTTCACTTGACCTTCAGAATGCGTCTTCCCAGAGATCTCGTGCATCTTATTTGATTTCCCC
TCACTCGTTGGGCTATCCTTCTCTATCTCCTCTTAATTCAAGATACATGTCACCATATTTTCCTAGTCCAGGAAATGCCTCGTCCAgTTA
TATTGGCTCCTCAAGTCGGCATCCCAACCCACTGCGTCATAGTGAGTCAACCACTAGCTTTTCGCCATTTGCTTCAGCTCAGTCTCTTCC
GGGATGTGAGTCGTGATGXTGTTGGTTCTGGAAAATCTGGGTTCAAGTTTGCXGCTACCCTTTTAACAAAGATCAATGAGTTTGGGTCAT
CTCAAATAACACCTAAAGACAATGCAACAGCTTTGGAGATGCAGCTCTGGCATATGGGCAGACAGGAAAATGACAGGAAGCCCTGG\(3')
ATTTGTATATTATTAGTGTGACACTAATGTTATAGATTTGGTTTCTATATTGAGATTTTTACTATTTTTATTTTGAGGCTTTTACGAGT
GCACGCGCAAAGCGATGGGTGTTCATGCTGTATGCAGTAGCCCTCTTTTACGTACCCTTCTTGTTTAGTGCTATGGATGTTAGCAGTTTC
CATTTGCAAGATGGTTTAGGTCTTTTTAGTTGAAACCTTTTGCTTAGGGTTTGAGCTTGTATGTATAGAGTATTGACCCAGATGACTGAA
GCTTCTAAGTTGAATGTAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan