ESTScan Details for Unigene SGN-U285327

Score 
472
Direction 
Forward
Predicted Peptide Sequence 
RACIYFVAKXATVFLHTQQDTGILPATIPQIWKEGSWVPKTPVYAQERPHIFQFVIVDSKCWTLAXLNKNKMLEIEKGANDLNIPIIRSN
RKLVASIDGGLHKPSCLVFNSAWKARQLEHEPNKKLNYPSPAGIQRPKSDEDIAFMSILELGQLLKANLITSVELTGIFLKRLKRYGPVL
ESVVTITEELAYKQTKEADQLLAESKYX
Predicted Coding Sequence 
CGTGCTTGTATTTACTTTGTTGCTAAAXTAGCAACTGTGTTTCTTCATACTCAACAGGATACTGGGATTTTACCTGCAACAATTCCACAG
ATATGGAAAGAGGGAAGTTGGGTCCCCAAAACCCCGGTGTATGCTCAGGAAAGGCCACACATCTTCCAGTTTGTGATTGTGGATTCAAAA
TGTTGGACTCTTGCTXTCTTGAATAAGAACAAGATGCTTGAAATCGAAAAGGGAGCAAATGACTTAAACATACCCATAATCAGATCCAAC
CGAAAGTTAGTTGCCTCTATTGATGGAGGTCTGCATAAACCGTCTTGTTTAGTCTTCAATTCTGCATGGAAGGCCCGACAACTAGAACAT
GAACCAAACAAAAAGCTCAATTATCCATCACCTGCTGGTATACAAAGACCAAAAAGTGACGAGGATATCGCATTCATGAGTATTCTTGAA
CTTGGTCAGCTTCTCAAGGCAAATTTAATCACATCAGTGGAGCTGACTGGAATTTTCTTGAAGAGACTGAAGAGGTATGGTCCTGTTCTT
GAATCGGTCGTTACAATTACTGAAGAATTAGCATACAAACAAACAAAAGAGGCTGATCAACTGCTTGCTGAAAGCAAATATTTX\
Edits in Original Sequence 
(5')CGTGCTTGTATTTACTTTGTTGCTAAAXTAGCAACTGTGTTTCTTCATACTCAACAGGATACTGGGATTTTACCTGCAACAATTCC
ACAGATATGGAAAGAGGGAAGTTGGGTCCCCAAAACCCCGGTGTATGCTCAGGAAAGGCCACACATCTTCCAGTTTGTGATTGTGGATTC
AAAATGTTGGACTCTTGCTXTCTTGAATAAGAACAAGATGCTTGAAATCGAAAAGGGAGCAAATGACTTAAACATACCCATAATCAGATC
CAACCGAAAGTTAGTTGCCTCTATTGATGGAGGTCTGCATAAACCGTCTTGTTTAGTCTTCAATTCTGCATGGAAGGCCCGACAACTAGA
ACATGAACCAAACAAAAAGCTCAATTATCCATCACCTGCTGGTATACAAAGACCAAAAAGTGACGAGGATATCGCATTCATGAGTATTCT
TGAACTTGGTCAGCTTCTCAAGGCAAATTTAATCACATCAGTGGAGCTGACTGGAATTTTCTTGAAGAGACTGAAGAGGTATGGTCCTGT
TCTTGAATCGGTCGTTACAATTACTGAAGAATTAGCATACAAACAAACAAAAGAGGCTGATCAACTGCTTGCTGAAAGCAAATATTTX\
(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan