ESTScan Details for Unigene SGN-U285353

Score 
307
Direction 
Forward
Predicted Peptide Sequence 
WWGIALNLIAYFVASHAVGACWYLLGIQRAAKCLKQQCRVTNGCSLSMLACEEQIFYGTSNLVKHKSRVIWGETKIPRSTCLASEHNFDY
GVYKWTVQLVTNENRFEKILFPIFWGLMTLSTFGNLESTTDWLEDVFIIIVLTTGLLLVTMLX
Predicted Coding Sequence 
XTTTGGTGGGGAATTGCTCTCAACTTGATTGCTTATTTTGTTGCCTCTCACGCAGTGGGAGCATGTTGGTACTTGCTAGGAATCCAAAGG
GCAGCAAAATGTTTGAAACAACAGTGCAGAGTTACAAATGGTTGTAGCCTAAGTATGTTGGCATGTGAAGAGCAAATATTTTATGGAACA
AGTAATTTGGTGAAGCATAAAAGTAGAGTCATATGGGGTGAGACCAAAATTCCAAGATCAACATGTCTAGCCTCTGAACACAATTTTGAT
TATGGAGTTTATAAATGGACTGTTCAACTTGTCACAAATGAGAATCGTTTCGAGAAAATATTATTTCCCATCTTCTGGGGTCTTATGACT
CTCAGTACATTTGGCAATTTGGAGAGCACAACAGATTGGTTGGAAGATGTATTCATAATCATTGTTCTCACTACTGGTCTTCTTCTTGTC
ACTATGTTGAXX\
Edits in Original Sequence 
(5')XTTTGGTGGGGAATTGCTCTCAACTTGATTGCTTATTTTGTTGCCTCTCACGCAGTGGGAGCATGTTGGTACTTGCTAGGAATCCA
AAGGGCAGCAAAATGTTTGAAACAACAGTGCAGAGTTACAAATGGTTGTAGCCTAAGTATGTTGGCATGTGAAGAGCAAATATTTTATGG
AACAAGTAATTTGGTGAAGCATAAAAGTAGAGTCATATGGGGTGAGACCAAAATTCCAAGATCAACATGTCTAGCCTCTGAACACAATTT
TGATTATGGAGTTTATAAATGGACTGTTCAACTTGTCACAAATGAGAATCGTTTCGAGAAAATATTATTTCCCATCTTCTGGGGTCTTAT
GACTCTCAGTACATTTGGCAATTTGGAGAGCACAACAGATTGGTTGGAAGATGTATTCATAATCATTGTTCTCACTACTGGTCTTCTTCT
TGTCACTATGTTGAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan