ESTScan Details for Unigene SGN-U285376

Score 
-50
Direction 
Forward
Predicted Peptide Sequence 
MGFLDHLSELCEFHRGTSRRKLSKLRRNQLETVEIRVKMDCEGCERRVRKSVEGMRGVTKVEVEPKKHKLTVIGYVDPDKVLRRVRHRTG
KKAEFWPYVPYDXGGSSLRAGLYDKKAPAGYVPNVYDNPQASKLARAX
Predicted Coding Sequence 
ATGGGTTTTCTAGATCATCTTTCTGAGCTCTGTGAATTCCATCGAGGCACTAGCAGAAGGAAGCTCAGCAAACTTAGGAGAAATCAACTT
GAGACAGTTGAAATAAGAGTGAAAATGGACTGCGAAGGGTGCGAAAGGAGGGTGAGGAAGTCGGTAGAAGGGATGCGAGGGGTGACGAAA
GTAGAAGTGGAGCCAAAGAAGCACAAGCTGACAGTTATTGGTTATGTTGATCCAGATAAAGTATTGCGACGAGTAAGACATCGTACGGGA
AAGAAGGCTGAATTTTGGCCATACGTTCCTTACGATXCTGGTGGATCATCCTTACGTGCGGGGCTGTATGATAAGAAGGCTCCGGCAGGA
TACGTCCCAAACGTCTATGATAACCCGCAGGCTTCGAAGCTGGCGAGGGCGAGX\
Edits in Original Sequence 
GGCACGAGGGTAGGATTTTGTTACGTTGCCAAAACTAATAAAAGAGTACGTAGTCGGTGCTTGCTGATTTGTGCTAGGGAA(5')ATGGG
TTTTCTAGATCATCTTTCTGAGCTCTGTGAATTCCATCGAGGCACTAGCAGAAGGAAGCTCAGCAAACTTAGGAGAAATCAACTTGAGAC
AGTTGAAATAAGAGTGAAAATGGACTGCGAAGGGTGCGAAAGGAGGGTGAGGAAGTCGGTAGAAGGGATGCGAGGGGTGACGAAAGTAGA
AGTGGAGCCAAAGAAGCACAAGCTGACAGTTATTGGTTATGTTGATCCAGATAAAGTATTGCGACGAGTAAGACATCGTACGGGAAAGAA
GGCTGAATTTTGGCCATACGTTCCTTACGATXCTGGTGGATCATCCTTACGTGCGGGGCgTGTATGATAAGAAGGCTCCGGCAGGATACG
TCCgCAAACGTCTATGATAACCCGCAGGCTTCGAAGCTGGCGAGGGCGAGX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan