Notice: After server upgrades, BLAST should be back now. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U285396

Score 
327
Direction 
Forward
Predicted Peptide Sequence 
LKLSEALTHSGFIQSSLDHSLFIKKQGTDITIILIYVDDMLVTGSNLALIEETKASLHQTFKIKDLGTLKFFLGMEFSRSSKGILVNQRK
YALEIISDLGIGNVKPAWTPLEANIKLTTQELDELMKGDELLKGTDDETLEDKTQYQRLIGKILYLTLSRPDIAFSVQTLSXVPTVAKKS
HWDAAVRVMKYIKREPALGILLSSXNFHTLRVFCDADWASCPTQGDQFQASLSSIEXSLVSX
Predicted Coding Sequence 
CTCAAATTATCTGAAGCATTAACACATTCAGGTTTCATCCAGAGCAGTTTAGATCATTCCTTGTTTATTAAGAAGCAAGGAACTGATATT
ACCATTATCTTGATATATGTAGATGACATGTTGGTAACGGGAAGTAATCTAGCTCTTATTGAAGAGACTAAAGCATCATTGCATCAGACA
TTCAAGATTAAAGACTTAGGGACTCTAAAATTTTTCCTTGGAATGGAGTTTAGCAGATCTTCCAAGGGAATACTTGTGAATCAGAGGAAA
TATGCACTTGAGATCATTTCAGACCTAGGAATTGGCAATGTGAAGCCTGCTTGGACACCTTTGGAGGCAAACATAAAGTTGACAACACAG
GAATTGGATGAATTGATGAAAGGAGATGAGTTACTGAAAGGAACAGATGATGAGACATTGGAGGACAAAACACAATATCAAAGACTGATT
GGAAAGATATTGTATTTGACGCTATCAAGACCTGATATTGCTTTCTCAGTACAGACACTTAGCCAXGTTCCTACAGTAGCCAAGAAATCT
CACTGGGATGCAGCAGTTAGAGTCATGAAGTACATTAAGAGAGAACCAGCTTTGGGAATTTTGTTGAGTAGTAAXAACTTCCACACATTA
AGAGTGTTCTGTGATGCAGATTGGGCTTCATGTCCAACACAAGGAGATCAGTTTCAGGCTTCCTTATCAAGCATTGAGXACTCATTAGTT
TCCTXX\
Edits in Original Sequence 
(5')CTCAAATTATCTGAAGCATTAACACATTCAGGTTTCATCCAGAGCAGTTTAGATCATTCCTTGTTTATTAAGAAGCAAGGAACTGA
TATTACCATTATCTTGATATATGTAGATGACATGTTGGTAACGGGAAGTAATCTAGCTCTTATTGAAGAGACTAAAGCATCATTGCATCA
GACATTCAAGATTAAAGACTTAGGGACTCTAAAATTTTTCCTTGGAATGGAGTTTAGCAGATCTTCCAAGGGAATACTTGTGAATCAGAG
GAAATATGCACTTGAGATCATTTCAGACCTAGGAATTGGCAATGTGAAGCCTGCTTGGACACCTTTGGAGGCAAACATAAAGTTGACAAC
ACAGGAATTGGATGAATTGATGAAAGGAGATGAGTTACTGAAAGGAACAGATGATGAGACATTGGAGGACAAAACACAATATCAAAGACT
GATTGGAAAGATATTGTATTTGACGCTATCAAGACCTGATATTGCTTTCTCAGTACAGACACTTAGCCAXGTTCCTACAGTAGCCtAAGA
AATCTCACTGGGATGCAGCAGTTAGAGTCATGAAGTACATTAAGAGAGAACCAGCTTTGGGAATTTTGTTGAGTAGTAAXAACTTCCACA
CATTAAGAGTGTTCTGTGATGCAGATTGGGCTTCATGTCCAACACAAGGAGATCAGTTTCAGGCTTCCTTATCAAGCATTGAGXACTCAT
TAGTTTCCTXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan