ESTScan Details for Unigene SGN-U285480

Score 
75
Direction 
Reverse
Predicted Peptide Sequence 
WVSDKHHVRGGGGIHRAITGDLTKNKEFGFNRTHTSGTEMSKSEECKWCRRLLQLISFRWYSKHSVFAVFGTEVRIFAALTNGREECVVQ
KCNLNFDIQKREKIVGXAIAGKFFILISTSIYIRAMRGYYSNIGSNNX
Predicted Coding Sequence 
XCTTGGGTCTCCGATAAGCACCATGTAAGGGGGGGGGGGGGTATTCATCGAGCAATAACTGGTGATTTGACCAAAAACAAGGAGTTTGGA
TTCAATAGAACACACACCTCAGGGACAGAGATGAGCAAAAGTGAAGAATGCAAGTGGTGTCGTCGTCTGCTTCAACTGATTTCCTTTCGT
TGGTACTCCAAGCATTCTGTATTTGCTGTTTTTGGCACTGAAGTGAGAATTTTTGCAGCATTGACCAATGGCAGAGAGGAGTGTGTTGTA
CAGAAATGTAATTTGAATTTTGATATACAAAAACGTGAAAAGATTGTTGGTXTGGCTATTGCTGGCAAGTTTTTCATATTAATATCAACT
AGTATATATATCCGTGCGATGCGTGGATATTATTCAAATATTGGTTCTAATAATTTX\
Edits in Original Sequence 
(5')XCTTGGGTCTCCGATAAGCACCATGTAAGGGGGGGGGGGGGTATTCATCGAGCAATAACTGGTGATTTGACCAAAAACAAGGAGTT
TGGATTCAATAGAACACACACCTCAGGGACAGAGATGAGCAAAAGTGAAGAATGCAAGTGGTGTCGTCGTCTGCTTCAACTGATTTCCTT
TCGTTGGTACTCCAAGCATTCTGTATTTGCTGTTTTTGGCACTGAAGTGAGAATTTTTGCAGCATTGACCAATGGCAGAGAGGAGTGTGT
TGTACAGAAATGTAATTTGAATTTTGATATACAAAAACGTGAAAAGATTGTTGGTXTGGCTATTGCTGGCAAGTTTTTCATATTAATATC
AACTAGTATATATATCCGTGCGATGCGTGGATATTATTCAAATATTGGTTCTAATAATTTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan