ESTScan Details for Unigene SGN-U285666

Score 
429
Direction 
Forward
Predicted Peptide Sequence 
GKSTFLEVLAGKIEPQSGSIFVNQKPVDKARFKKISGYVTQKDTLFPLLTVEETLSFSAKLRLKLAPKELSSRVKCLIQELGLEHVAGAR
IGDDRIRGISGGERRRVSIGVELIHDPGVLILDEPTSGLDSTSALQIIDMLKTMAVTRDRTIILSIHQPCFRIMKLFNSILLLANGTILH
HGTIEQLSLRLILLGLDLPFHVNILEFAIESIDXNPETNHTLLPQSALMIX
Predicted Coding Sequence 
GGAAAGTCTACTTTTTTAGAAGTTTTAGCAGGTAAGATTGAGCCACAAAGTGGATCTATTTTTGTGAACCAAAAACCAGTTGATAAAGCA
AGGTTTAAGAAGATTTCAGGCTATGTTACACAAAAGGACACTCTGTTTCCTCTGTTAACTGTTGAAGAAACATTAAGTTTTAGTGCAAAA
CTAAGGTTAAAACTTGCTCCTAAAGAATTGAGTTCAAGGGTTAAGTGTCTGATTCAAGAACTTGGTTTAGAACATGTTGCTGGTGCTAGG
ATTGGTGATGATCGAATTCGAGGGATTTCAGGTGGTGAAAGGAGGAGAGTTTCTATAGGAGTTGAACTGATTCATGACCCTGGAGTCTTG
ATTCTTGATGAACCAACTTCAGGTCTTGACAGTACTTCAGCATTGCAGATCATTGACATGCTTAAAACCATGGCTGTTACTCGTGATCGA
ACGATAATTCTTAGTATTCATCAGCCATGTTTTAGGATCATGAAGTTGTTCAACTCAATCCTACTTTTGGCTAATGGTACAATCTTGCAT
CATGGAACCATTGAACAGCTTAGTTTAAGGTTAATCCTATTAGGATTAGACCTTCCCTTTCATGTCAACATACTTGAATTCGCCATCGAA
TCGATTGACATXAATCCAGAAACAAACCACACGTTGTTGCCTCAATCAGCACTTATGATCAXX\
Edits in Original Sequence 
(5')GGAAAGTCTACTTTTTTAGAAGTTTTAGCAGGTAAGATTGAGCCACAAAGTGGATCTATTTTTGTGAACCAAAAACCAGTTGATAA
AGCAAGGTTTAAGAAGATTTCAGGCTATGTTACACAAAAGGACACTCTGTTTCCTCTGTTAACTGTTGAAGAAACATTAAGTTTTAGTGC
AAAACTAAGGTTAAAACTTGCTCCTAAAGAATTGAGTTCAAGGGTTAAGTGTCTGATTCAAGAACTTGGTTTAGAACATGTTGCTGGTGC
TAGGATTGGTGATGATCGAATTCGAGGGATTTCAGGTGGTGAAAGGAGGAGAGTTTCTATAGGAGTTGAACTGATTCATGACCCTGGAGT
CTTGATTCTTGATGAACCAACTTCAGGTCTTGACAGTACTTCAGCATTGCAGATCATTGACATGCTTAAAACCATGGCTGTTACTCGTGA
TCGAACGATAATTCTTAGTATTCATCAGCCATGTTTTAGGATCATGAAGTTGTTCAACTCAATCCTACTTTTGGCTAATGGTACAATCTT
GCATCATGGAACCATTGAACAGCTTAGTTTAAGGTTAATCCTATTAGGATTAGACCTTCCCTTTCATGTCAACATACTTGAATTCGCCAT
CGAATCGATTGACATXAATCCAGAAACAAACCACACGTTGTTGCCTCAATCAGCACTTATGATCAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan