ESTScan Details for Unigene SGN-U285701

Score 
387
Direction 
Forward
Predicted Peptide Sequence 
MKLETIKGKTINDTKSLVXDIWSDMTSEFHVLNIILLRSFSVQVEFVGGPMCWNTRIFSAAAGKGAFANGEKIHVSRTDKVEQSLLVTGF
GYEHDDPWATNMELFKEFTDAAGGGEGFGAAAVDMCHVALGIAEAYWEYRLKAWDMAA
Predicted Coding Sequence 
ATGAAATTGGAAACCATAAAGGGGAAGACTATCAATGACACCAAATCTCTTGTTXCTGATATCTGGTCAGATATGACATCTGAATTCCAT
GTCCTGAACATAATATTGTTAAGGTCTTTTTCTGTACAGGTTGAGTTTGTTGGTGGCCCTATGTGTTGGAATACTCGAATATTTTCTGCA
GCTGCAGGCAAAGGAGCCTTTGCTAATGGTGAAAAGATTCATGTCAGTCGAACTGACAAGGTGGAACAATCTCTTCTAGTGACTGGATTT
GGATATGAGCATGATGATCCATGGGCAACCAATATGGAATTGTTCAAAGAATTTACTGATGCAGCAGGGGGTGGAGAAGGCTTTGGTGCT
GCTGCAGTGGATATGTGTCATGTTGCTTTGGGGATTGCTGAAGCATATTGGGAATATCGTCTXAAAGCATGGGACATGGCTGCX\
Edits in Original Sequence 
AACCTTACAAATGTTATATAGTTGAAAAGTGACTAGCTTTAACATTGCTATAAGATTTTATTTCTGAGGCTATCCATAATTTATGTAGGA
TGTGTTAGTTGAACTATAATAGATGCTGCCGAATTCAACCCTGGCAACTCTGCATTTCTTAATTCACTGAAGATTTGAATTAGCTGACCA
ACCAAAATTATGTGACGTTTATCTAATAGTAACTTTTATGTAGTATACAGACTCTCAGAGGAAGACTGAGAGA
(5')ATGAAATTGGAAA
CCATAAAGcGGGAAGACTATCAATGACACCAAATCTCTTGTTXCTGATATCTGGTCAGATATGACATCTGAATTCCATGTCCTGAACATA
ATATTGTTAAGGTCTTTTTCTGTACAGGTTGAGTTTGTTGGTGGCCCTATGTGTTGGAATACTCGAATATTTTCTGCAGCTGCAGGCAAA
GGAGCCTTTGCTAATGGTGAAAAGATTCATGTCAGTCGAACTGACAAGGTGGAACAATCTCTTCTAGTGACTGGATTTGGATATGAGCAT
GATGATCCATGGGCAACCAATATGGAATTGTTCAAAGAATTTACTGATGtCAGCAGGGGGTGtGAGAAGGCTTTGGTGCTGCTGCAGTGG
ATATGTGTCATGTTGCTTTGGGGATTGCTGAAGCATATTGGGAATATCGTCTXAAAGCATGGGACATGGCTGCX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan