ESTScan Details for Unigene SGN-U285977

Score 
203
Direction 
Forward
Predicted Peptide Sequence 
QIAAMQCALIAIVIGIQDPNPAPFAXGNLKRVKSRDLWVLTCNDEVVDPETVSKEDLLHFYLYVNSLPKDSPDAVVLDVL
Predicted Coding Sequence 
CAAATTGCTGCCATGCAATGTGCATTAATTGCTATCGTGATTGGAATACAAGATCCGAATCCTGCCCCTTTTGCCGXTGGTAACTTGAAG
AGAGTTAAGTCAAGAGACTTATGGGTTCTCACCTGCAATGATGAAGTTGTTGATCCTGAGACTGTTTCCAAAGAGGATTTATTGCATTTC
TATCTGTATGTTAACAGTCTGCCTAAGGATTCTCCTGATGCXGTTGTTCTTGATGTATTATGA\
Edits in Original Sequence 
(5')CAAATTGCTGCCATGCAATGTGCATTAATTGCTATCGTGATTGGAATACAAGATCCGAATCCTGCCCCTTTTGCCGXTGGTAACTT
GAAGAGAGTTAAGTCAAGAGACTTATGGGTTCTCACCTGCAATGATGAAGTTGTTGATCCTGAGACTGTTTCCAAAGAGGATTTATTGCA
TTTCTATCTGTATGTTAACAGTCTGCCTAAGGATTCTCCTGATGCXGTTGTTCTTGATGTATTATGA\(3')ATACCTAATATGACATAA
AACATTTGAGATAAATAGTGTACAGATAGAGAAAGAAAACCTTCAAATGTACATAATTCTGGTGGGAGAAATTCTCCTAAATTTCACAGA
GAAATAAGCACCTCCATGAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan