ESTScan Details for Unigene SGN-U286092

Score 
419
Direction 
Reverse
Predicted Peptide Sequence 
MNAKYIVLQINIPQNEEHTSYGHNQEDNKPWKTDIHSRIMKTIDDRGSFFIQARVPALMQCDSLRPVKEECTQSEIRREYGKLEGNVFSP
LLSLIVFFGLYLTADIAAVLVEFCNIMTWKLRISARADGDFLKVITADENKMLKLGKSSADAFQVTKFVLSIHNTSREQKPPVDSQDSPX
THFLSSSGLQGVPTXPNIDISFHSNQVSNKVSFLNFVGNMYAGGRRNFPV
Predicted Coding Sequence 
ATGAATGCAAAATACATTGTTCTTCAGATTAACATACCACAAAATGAAGAACATACAAGCTATGGCCACAATCAAGAAGACAACAAACCA
TGGAAGACGGACATCCACTCAAGAATTATGAAAACAATTGATGATAGAGGCTCTTTCTTTATCCAAGCTAGGGTACCAGCTCTCATGCAG
TGTGATTCATTGAGACCTGTGAAGGAGGAGTGCACACAATCAGAGATCAGGAGGGAATATGGAAAGCTTGAAGGCAATGTTTTTAGTCCC
TTGTTGAGTTTGATTGTCTTTTTTGGCTTGTATTTGACTGCAGATATTGCTGCTGTTTTGGTGGAATTTTGCAACATCATGACTTGGAAA
CTGCGTATATCAGCTAGGGCXGATGGGGACTTCCTTAAGGTAATCACAGCAGATGAGAACAAGATGCTTAAGCTTGGAAAGTCATCAGCT
GATGCTTTCCAAGTAACTAAGTTTGTCCTTTCAATCCACAACACCAGTAGGGAACAAAAACCACCAGTAGACTCCCAGGACTCTCCCTAA
ACCCATTTTCTTTCATCTTCAGGACTTCAAGGTGTTCCAACTGAXCCCAATATAGACATATCTTTCCACTCCAACCAGGTGTCTAATAAA
GTCAGCTTCCTCAACTTTGTTGGAAATATGTATGCAGGTGGAAGGCGTAACTTTCCTGTTTGA\
Edits in Original Sequence 
ACTAAAATGAAATAAATAGTCTTTACAAGGGATTACATAAAATACTATAACTCAACCACATGATTAATAGTATATCCCACCAAGAGTGAC
CTCCAATTTGACCTGGTGAAGGTATAGGAGAAAGTATTTTCATAATACTTCCCTCCAAGCCTCCAAACGAAACAATATCCAAGCCTAGAA
CCTCCCCATACATATAATTTCTTACAATATTACACAGCTCTGAAGCCAAAGACTACAGAATAG
(5')ATGAATGCAAAATACATTGTTCT
TaCAGATTAACATACCACAAAATGAAGAACATACAAGCTATGGCCACAATCAAGAAGACAACAAACCATGGAAGACGGACATCCACTCAA
GAATTATGAAAACAATTGATaGATAGAGGCTCTTTCTTTATCCAAGCTAGGGTACCAGCTCTCATGCAGTGTGATTCATTGAgGACCTGT
GAAGGAGGAGTGCACACAATCAGAGATCAGGAGGGAATATGGAAAGCTTGAAGGCAATGTTTTTAGTCCCTTGTTGAGTTTGATTGTCTT
TTTTGGCTTGTATTTGACgTGCAGATATTGCTGCTGTTTTGGTGGAATTTTGCAACATCATGACTTGGAAACTGCGTATATCAGCTAGGG
CXGATGGGGACTTCCTTAAGGTAATCACAGCAGATGAGAACAAGATGCTTAAGtCTTGGAAAGTCATCAGCTGATGCTTTCCAAGTAACT
AAGTTTGTCCTTTCAATCCACAACACCAGTAGGGAACAAAAACCACCAGTAGACTCCCAGGACTCTCCCgTAAACCCATTTTCTTTCATC
TTCAGGACTTCAAGGTGTTCCAACTGAXCCCAATATAGACATATCTTTCCACTCCAACCAGGTGTCTAATAAAGTCAGCTTCCTCAACTT
TGTTGGAAATATGTATGCAGGTGGAAGGCGTAACTTTCCTGTTTGA\(3')ATGCTACTATCATTTATCAGCTTCAAGTTTTCAAGGTAT
TCTAGCCTCTTCACATTTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan