ESTScan Details for Unigene SGN-U286132

Score 
876
Direction 
Forward
Predicted Peptide Sequence 
NFRDDDERTALHVAACQGYSDVVQLLVDNGAEIDSEDRWGSTPLGDAIHYKNHHVIKLLEEHGAKPPMAPMHVNNSREVPEYEIDAKELD
FTNSIELAKGTFHIASWRGIQVAVKKFGDDEIADEDKVTAFRDELALLQKIRHPNVVQFLGAVTQSSPMMIVTEYLPKGDLHAYLKNEEP
LRPTKAIRFAIDIARGLNYLHEIRPEAIIHRDLEPSNILRDDTGHLKVADFGVSKLLKVTNRVKEDKPLTCDNTSCRYVAPEVFKNEEYD
TKVDXLFPLLNFARDD
Predicted Coding Sequence 
XXGAACTTTCGAGACGATGATGAGAGGACTGCCCTACATGTTGCTGCTTGCCAAGGTTACAGTGATGTTGTGCAGCTGTTGGTTGATAAT
GGGGCTGAAATTGATTCCGAAGATCGCTGGGGAAGCACGCCTTTAGGAGATGCAATACATTATAAAAATCATCATGTGATCAAGCTACTA
GAGGAACATGGTGCCAAGCCTCCTATGGCTCCCATGCATGTCAACAATTCACGTGAAGTTCCAGAATATGAGATTGATGCTAAAGAACTT
GATTTCACGAACAGCATTGAATTGGCCAAGGGAACCTTTCATATTGCCTCATGGCGTGGAATACAAGTTGCTGTGAAAAAGTTTGGAGAT
GATGAGATTGCTGATGAGGATAAAGTGACGGCATTCAGAGACGAGCTTGCACTTCTCCAGAAGATTAGGCATCCAAATGTCGTCCAATTT
CTTGGTGCTGTAACACAAAGTAGCCCGATGATGATAGTGACAGAATACTTACCAAAGGGCGATCTCCATGCATATTTGAAGAATGAAGAA
CCTCTTAGACCAACAAAAGCTATCAGATTTGCAATAGACATCGCAAGGGGACTGAACTATCTACATGAAATTAGACCTGAAGCGATTATT
CATCGTGACCTAGAGCCTTCAAATATTTTGAGGGATGATACGGGACACCTGAAAGTTGCTGATTTTGGAGTCAGCAAGCTATTGAAAGTT
ACCAACAGGGTCAAAGAAGATAAGCCTCTGACATGTGATAACACATCTTGCCGATATGTAGCTCCAGAGGTTTTCAAAAATGAGGAATAC
GATACCAAAGTTGATGXTCTTTTCCCTTTGCTTAATTTTGCAAGAGATGATTGA\
Edits in Original Sequence 
(5')XXGAACTTTCGAGACGATGATGAGAGGACTGCCCTACATGTTGCTGCTTGCCAAGGTTACAGTGATGTTGTGCAGCTGTTGGTTGA
TAATGGGGCTGAAATTGATTCCGAAGATCGCTGGGGAAGCACGCCTTTAGGAGATGCAATACATTATAAAAATCATCATGTGATCAAGCT
ACTAGAGGAACATGGTGCCAAGCCTCCTATGGCTCCCATGCATGTCAACAATTCACGTGAAGTTCCAGAATATGAGATTGATGCTAAAGA
ACTTGATTTCACGAACAGCATTGAATTGGCCAAGGGAACCTTTCATATTGCCTCATGGCGTGGAATACAAGTTGCTGTGAAAAAGTTTGG
AGATGATGAGATTGCTGATGAGGATAAAGTGACGGCATTCAGAGACGAGCTTGCACTTCTCCAGAAGATTAGGCATCCAAATGTCGTCCA
ATTTCTTGGTGCTGTAACACAAAGTAGCCCGATGATGATAGTGACAGAATACTTACCAAAGGGCGATCTCCATGCATATTTGAAGAATGA
AGAACCTCTTAGACCAACAAAAGCTATCAGATTTGCAATAGACATCGCAAGGGGACTGAACTATCTACATGAAATTAGACCTGAAGCGAT
TATTCATCGTGACCTAGAGCCTTCAAATATTTTGAGGGATGATACGGGACACCTGAAAGTTGCTGATTTTGGAGTCAGCAAGCTATTGAA
AGTTACCAACAGGGTCAAAGAAGATAAGCCTCTGACATGTGATAACACATCTTGCCGATATGTAGCTCCAGAGGTTTTCAAAAATGAGGA
ATACGATACCAAAGTTGATGXTCTTTTCCCTTTGCTTAATTTTGCAAGAGATGATTGA\(3')AGGCTGCCCCCCCTTTCAAGCAAGATG
ANNATGAGTACCTAACACTATGCTGCTAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan