ESTScan Details for Unigene SGN-U286144

Score 
522
Direction 
Forward
Predicted Peptide Sequence 
RHHLYVMEIHQIAQLLNQTLSPDGAVINAATNALDHLSTLPEFPFTLLSIAIGGENGGQKVAAATYLKNFTRRNVDSIDTNSGITKEFRD
AFVRALLHAEPMTLKILVEAFRSIIAVEFVKKDAWPELVPELRSVIQRSDMIDKNPNSEWKTINALTILHSLIRPFQYFLNPKLVKEPVP
PQLELITXEILVPLLAVFHLCTEKVSDAQHTSEVQKKLSFSSHASASIFAVKSHMPSALAPLLX
Predicted Coding Sequence 
XTGCGCCACCACTTATACGTTATGGAAATTCATCAAATTGCTCAGCTCCTCAATCAAACTCTGAGCCCCGACGGTGCCGTCATCAATGCC
GCCACCAATGCTCTCGATCACCTCTCTACTCTCCCAGAATTTCCCTTCACTCTGCTCTCTATCGCCATAGGAGGTGAGAACGGAGGTCAG
AAAGTAGCTGCAGCCACATATCTCAAGAACTTCACTAGAAGAAATGTTGATTCCATTGATACAAATTCAGGAATCACCAAAGAGTTTAGA
GATGCATTTGTGCGCGCTTTGCTTCATGCCGAACCTATGACTCTTAAAATATTAGTTGAAGCTTTTCGCTCAATTATTGCAGTTGAGTTT
GTGAAGAAGGATGCTTGGCCTGAGCTTGTGCCTGAGCTAAGGTCGGTCATTCAGCGCAGTGATATGATTGATAAGAATCCGAATTCTGAA
TGGAAAACCATCAACGCTCTAACCATTCTTCACTCACTGATTAGACCCTTCCAGTACTTTTTGAATCCAAAACTTGTGAAGGAGCCAGTT
CCACCACAGCTAGAACTTATTACAANAGAGATCCTTGTACCCTTACTTGCTGTATTTCACCTCTGCACCGAAAAGGTATCAGATGCCCAA
CATACATCAGAAGTGCAGAAGAAACTATCCTTCTCATCACATGCAAGTGCATCTATTTTTGCGGTGAAATCTCACATGCCGTCTGCCTTG
GCTCCTCTGCTTCXX\
Edits in Original Sequence 
(5')XTGCGCCACCACTTATACGTTATGGAAATTCATCAAATTGCTCAGCTCCTCAATCAAACTCTGAGCCCCGACGGTGCCGTCATCAA
TGCCGCCACCAATGCTCTCGATCACCTCTCTACTCTCCCAGAATTTCCCTTCACTCTGCTCTCTATCGCCATAGGAGGTGAGAACGGAGG
TCAGAAAGTAGCTGCAGCCACATATCTCAAGAACTTCACTAGAAGAAATGTTGATTCCATTGATACAAATTCAGGAATCACCAAAGAGTT
TAGAGATGCATTTGTGCGCGCTTTGCTTCATGCCGAACCTATGACTCTTAAAATATTAGTTGAAGCTTTTCGCTCAATTATTGCAGTTGA
GTTTGTGAAGAAGGATGCTTGGCCTGAGCTTGTGCCTGAGCTAAGGTCGGTCATTCAGCGCAGTGATATGATTGATAAGAATCCGAATTC
TGAATGGAAAACCATCAACGCTCTAACCATTCTTCACTCACTGATTAGACCCTTCCAGTACTTTTTGAATCCAAAACTTGTGAAGGAGCC
AGTTCCACCACAGCTAGAACTTATTACAANAGAGATCCTTGTACCCTTACTTGCTGTATTTCACCTCTGCACCGAAAAGGTATCAGATGC
CCAACATACATCAGAAGTGCAGAcAGAAACTATCCTTCTCATCACATGCAAGTGCATCTATTTTTGCGGTGAAATCTCACATGCCGTCTG
CCTTGGCTCCTCTGCTTCXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan