ESTScan Details for Unigene SGN-U286165

Score 
499
Direction 
Reverse
Predicted Peptide Sequence 
GVQSHNSAPVQSLPSYAYGNSVAAMPPHTQPAYPTSSYSYPSYYGMAPPPPLPPTATQSGVDHSQSMSNVPWASNPPEPAPAPPPPPPPS
AEKPPYGTDAEYEKFMSEMKDDAVNFVFACSTWYGNVTVATFCFGVQSWFALFMPYVCTHTHTVTLTLGHLDFLADLMVPGAEGESCLIT
TDS
Predicted Coding Sequence 
XXCGGAGTGCAATCTCATAATAGTGCTCCTGTTCAATCGCTTCCCAGTTATGCNTATGGCAATTCCGTCGCTGCAATGCCACCCCATACC
CAACCTGCATATCCAACATCTTCATACAGCTATCCTTCTTATTATGGCATGGCACCACCACCTCCTCTTCCTCCAACTGCAACACAGTCC
GGTGTAGATCATTCACAGAGTATGAGCAATGTTCCCTGGGCCTCAAATCCACCAGAACCTGCACCTGCACCTCCACCTCCACCTCCACCA
TCTGCAGAGAAACCTCCATATGGTACAGATGCAGAGTATGAAAAGTTCATGTCGGAGATGAAAGATGATGCAGTTAACTTTGTATTTGCT
TGTAGTACATGGTATGGAAATGTTACAGTTGCAACTTTTTGTTTTGGTGTACAATCTTGGTTTGCACTTTTCATGCCTTACGTATGCACT
CATACTCACACAGTCACACTTACCCTGGGACATCTTGATTTCTTAGCXGATCTTATGGTACCTGGGGCTGAAGGAGAATCATGTCTTATT
ACCACAGACTCATAG\
Edits in Original Sequence 
(5')XXCGGAGTGCAATCTCATAATAGTGCTCCTGTTCAATCGCTTCCCAGTTATGCNTATGGCAATTCCGTCGCTGCAATGCCACCCCA
TACCCAACCTGCATATCCAACATCTTCATACAGCTATCCTTCTTATTATGGCATGGCACCACCACCTCCTCTTCCTCCAACTGCAACACA
GTCCGGTGTAGATCATTCACAGAGTATGAGCAATGTTCCCTGGGCCTCAAATCCACCAGAACCTGCACCTGCACCTCCACCTCCACCTCC
ACCATCTGCAGAGAAACCTCCATATGGTACAGATGCAGAGTATGAAAAGTTCATGTCGGAGATGAAAtGATGATGCAGTTAACTTTGTAT
TTGCTTGTAGTACATGGTATGGAAATGTTACAGTTGCAACTTTTTGTTTTGGTGTACAATCTTGGTTTGCACTTTTCATGCCTTACGTAT
GCACTCATACTCACACAGTCACACTTACCCTGGGACATCTTGATTTCTTAGCXGATCTTATGGTACCTGGGGCTGAAGGAGAATCATGTC
TTATTACCACAGACTCATAG\(3')CTGATGATAACTCACTGTTTTCCACCTATAGTCCCCACCCACACACACACTCTCCTTTTTTGAGG
GGTGGGGGTACTTATATATTAGCCATACTCATAGGTGCTTTCTGTATCTAACCTTTTCAGCATCTTTTGTGACCATTTCTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan