ESTScan Details for Unigene SGN-U286195

Score 
418
Direction 
Forward
Predicted Peptide Sequence 
KYDEASNLFVRMQEAGIKPGQVSCNVMINVYAAAGLYQEAEVLMHSMRSSGCKPDSLTYLALIRAYTRVGECSEAEKAIDSMQKEGIPPS
CAHFNVLLSGFAKGGLIREVERIYNNLMNAELQPNLESHSLMLRCYMDYGHVEEGISFFERISKSVKPDRFIMSAAVHLYRSAGLVLKAE
GVLRSMNSFGIPFLEKLEVGSKLKAADSSAXTGPFNELLXGMRLNAKLQLPHIKYAIVLRLAGCQGHTSKAGAKLILCEGVDXVEITCNI
DFGNVCHTAQGRVSEYQCVDDLTGRGTSQVTNMVDSD
Predicted Coding Sequence 
XXGAAATATGATGAAGCATCTAATCTATTTGTCAGAATGCAGGAAGCAGGGATAAAACCTGGACAGGTGAGCTGCAATGTTATGATCAAT
GTATATGCGGCTGCTGGACTTTATCAAGAAGCTGAAGTCCTCATGCATAGCATGCGGAGCAGTGGTTGCAAACCTGACTCCCTAACCTAT
CTTGCACTGATTAGAGCATATACAAGGGTGGGAGAGTGCTCAGAGGCTGAAAAGGCCATTGATTCTATGCAGAAAGAAGGAATTCCCCCT
TCTTGTGCTCATTTTAACGTGTTGCTATCAGGTTTTGCAAAAGGGGGATTAATTAGAGAAGTAGAAAGGATTTATAATAATCTCATGAAT
GCTGAACTACAACCTAACCTAGAGTCTCATAGTCTTATGCTTAGATGTTACATGGACTATGGTCATGTGGAGGAAGGCATTTCCTTCTTT
GAACGAATCTCCAAGTCTGTAAAACCTGACCGGTTTATAATGAGTGCAGCTGTGCATTTGTACAGGTCAGCAGGCTTAGTACTCAAAGCA
GAAGGGGTGTTGAGGTCTATGAACAGTTTTGGGATTCCCTTCTTGGAGAAACTTGAAGTTGGATCAAAATTGAAAGCTGCTGATTCATCA
GCAXTAACTGGACCTTTTAATGAACTTCTTGXTGGGATGAGACTGAATGCCAAATTACAATTACCTCATATCAAGTATGCAATTGTGCTT
AGACTAGCTGGATGCCAAGGTCATACCAGCAAGGCTGGAGCTAAGCTAATATTATGTGAAGGAGTTGATXCAGTTGAAATAACATGCAAC
ATTGACTTTGGCAATGTCTGTCACACTGCTCAAGGCAGAGTATCTGAGTATCAATGTGTTGATGATCTTACTGGGCGGGGTACTTCCCAA
GTCACGAATATGGTGGATTCTGACTAA\
Edits in Original Sequence 
(5')XXGAAATATGATGAAGCATCTAATCTATTTGTCAGAATGCAGGAAGCAGGGATAAAACCTGGACAGGTGAGCTGCAATGTTATGAT
CAATGTATATGCGGCTGCTGGACTTTATCAAGAAGCTGAAGTCCTCATGCATAGCATGCGGAGCAGTGGTTGCAAACCTGACTCCCTAAC
CTATCTTGCACTGATTAGAGCATATACAAGGGTGGGAGAGTGCTCAGAGGCTGAAAAGGCCATTGATTCTATGCAGAAAGAAGGAATTCC
CCCTTCTTGTGCTCATTTTAACGTGTTGCTATCAGGTTTTGCAAAAGGGGGATTAATTAGAGAAGTAGAAAGGATTTATAATAATCTCAT
GAATGCTGAACTACAACCTAACCTAGAGTCTCATAGTCTTATGCTTAGATGTTACATGGACTATGGTCATGTGGAGGAAGGCATTTCCTT
CTTTGAACGAATCTCCAAGTCTGTAAAACCTGACCGGTTTATAATGAGTGCAGCTGTGCATTTGTACAGGTCAGCAGGCTTAGTACTCAA
AGCAGAAGGGGTGTTGAGGTCTATGAACAGTTTTGGGATTCCCTTCTTGGAGAAACTTGAAGTTGGATCAAAATTGAAAGCTGaCTGATT
CATCAGCAXTAACTGGACCTTTTAATGAACTTCTTGXTGGGATGAGACTGAATGCCAAATTACAATTACCTCATATCAAGTATGCAATTG
TGCTTAGACTAGCgTGGATGCCAAGGTCATACCAGCAAGGCTGGAGCTAAGCTAATATTATGTGAAGGAGTTGATXCAGTTGAAATAACA
TGCAACATTGACTTTGGCAATGTCTGTCACACTGCTCAAGGCAGAGTATCTGAGTATCAATGTGTTGATGATCTTACTGGGCGGGGTACT
TCCCAAGTCACGAATATGGTGGATTCTGACTAA\(3')ACAATTTTGAAGGCCTGAGAAGTATGATGTAGTGTAAATAGTATTTAGTTTG
TATCTCTTACTGCTTATACCATAAAAATGATTAAGCTTTATGTACAAGCGTTGACACCAAGTGTCGGTAACTTCGTATATTTAGTTTTAT
TTAGAAGTCATGCAAAGTATACGATTCTAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan