ESTScan Details for Unigene SGN-U286280

Score 
567
Direction 
Forward
Predicted Peptide Sequence 
DDVEKQLRESKFESSSELISMVVEKLECETNKALIYFRWIEESGLFKHNEQTFNAIARVLGREEFSEKFWKLVDEMRTAGFEMEKETYIR
VLDNFVKRKMIKDAVDLYEFAMVGINKPSSEDCTFLLKKIVVSKELDLELFSKVLRVFTESGNSLTSANLDAILKSLTSVDRFGECNKIL
KAMDDAGFTPSHNQQRKIAFNLGSGGKDKESNEFMNYIESTVSTPNSKTWTSLIEGYCEAGDLAKASEAFEMMIEKEGSSHAGYALXALS
VLALPQEKSDSAFNLVEKMVNEQRTTCVDIPHYKVL
Predicted Coding Sequence 
GAXGATGATGTGGAAAAGCAGCTGCGAGAGTCAAAATTCGAGTCCTCGAGTGAATTGATCAGTATGGTGGTAGAGAAGCTTGAATGTGAA
ACTAATAAGGCTTTGATATACTTTAGGTGGATTGAAGAGAGTGGTCTATTTAAACACAATGAGCAGACATTTAATGCTATCGCAAGGGTC
TTAGGTAGGGAAGAGTTCAGTGAGAAGTTCTGGAAGTTAGTTGATGAAATGAGAACTGCAGGATTTGAAATGGAAAAAGAAACATATATT
AGGGTTCTGGATAACTTTGTTAAGAGGAAAATGATTAAGGATGCCGTGGACTTATATGAGTTTGCAATGGTTGGCATAAACAAGCCATCC
TCGGAGGACTGCACTTTTCTATTGAAGAAAATAGTTGTTAGCAAGGAGCTTGATTTGGAATTGTTCTCAAAAGTTTTAAGGGTCTTCACA
GAAAGTGGCAATTCATTGACTAGTGCTAACCTCGATGCCATTCTCAAGTCTTTGACCAGTGTTGATAGATTTGGCGAATGTAACAAGATA
TTGAAAGCAATGGATGATGCTGGTTTCACACCTAGTCATAATCAGCAGAGGAAAATTGCTTTTAATTTGGGTAGTGGTGGGAAGGATAAG
GAATCCAATGAGTTTATGAATTATATAGAATCAACTGTCTCTACTCCAAATTCTAAAACATGGACATCTTTAATTGAAGGATACTGTGAA
GCGGGTGATCTGGCTAAAGCTTCAGAAGCATTTGAAATGATGATCGAAAAGGAAGGGTCATCCCATGCTGGGTATGCTTTAGXAGCTCTT
AGTGTCCTTGCACTGCCGCAAGAGAAGAGCGATTCAGCATTCAATCTTGTCGAGAAGATGGTCAATGAGCAAAGAACTACATGTGTGGAC
ATACCACATTATAAGGTTCTX\
Edits in Original Sequence 
(5')GAXGATGATGTGGAAAAGCAGCTGCGAGAGTCAAAATTCGAGTCCTCGAGTGAATTGATCAGTATGGTGGTAGAGAAGCTTGAATG
TGAAACTAATAAGGCTTTGATATACTTTAGGTGGATTGAAGAGAGTGGTCTATTTAAACACAATGAGCAGACATTTAATGCTATCGCAAG
GGTCTTAGGTAGGGAAGAGTTCAGTGAGAAGTTCTGGAAGTTAGTTGATGAAATGAGAACTGCAGGATTTGAAATGGAAAAAGAAACATA
TATTAGGGTTCTGGATAACTTTGTTAAGAGGAAAATGATTAAGGATGCCGTGGACTTATATGAGTTTGCAATGGTTGGCATAAACAAGCC
ATCCTCGGAGGACTGCACTTTTCTATTGAAGAAAATAGTTGTTAGCAAGGAGCTTGATTTGGAATTGTTCTCAAAAGTTTTAAGGGTCTT
CACAGAAAGTGGCAATTCATTGACTAGTGCTAACCTCGATGCCATTCTCAAGTCTTTGACCAGTGTTGATAGATTTGGCGAATGTAACAA
GATATTGAAAGCAATGGATGATGCTGGTTTCACACCTAGTCATAATCAGCAGAGGAAAATTGCTTTTAATTTGGGTAGTGGTGGGAAGGA
TAAGGAATCCAATGAGTTTATGAATTATATAGAATCAACTGTCTCTACTCCAAATTCTAAAACATGGACATCTTTAATTGAAGGATACTG
TGAAGCGGGTGATCTGGCTAAAGCTTCAGAAGCATTTGAAATGATGATCGAAAAGGAAGGGTCATCCCATGCTGGGTATGCTTTAGXAGC
TCTTAGTGTCCTTGCACTGCCGCAAGAGAAGAGCGATTCAcGCATTCAATCTTGTCGAGAAGATGGTCAATGAGCAAAGAACTACATGTG
TGGACATACCACATTATAAGGTTCTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan