ESTScan Details for Unigene SGN-U286342

Score 
512
Direction 
Forward
Predicted Peptide Sequence 
DAGDTEKCYDMYEKMKTSGIKPTINTIHPLIRASKKGKNGLVSINKIVEEMSQMDLSPDRVVYNELIHCYALHGEVQKSLAMHREMMERG
IPSDKRTYNSLIMVHLKEGKCQEAKNLVDQMKANSIIPNDETYNILVEGHCKLKDFSGAYIWYREMVDNGLIPVANICDELLSGLREEGR
LEETQIKCSEMSSEGIEECNTNEDISAVXEIVGQRRHCTPAL
Predicted Coding Sequence 
XXAGATGCAGGGGACACCGAAAAGTGTTATGACATGTATGAGAAGATGAAAACCTCTGGCATAAAACCTACAATCAACACAATTCATCCT
CTAATTAGAGCGTCCAAAAAGGGAAAGAATGGACTGGTGTCAATTAACAAAATTGTTGAAGAAATGTCTCAGATGGATCTTTCTCCTGAC
CGAGTTGTATATAACGAGCTCATCCATTGCTATGCTCTACATGGAGAAGTTCAAAAGTCACTTGCTATGCACCGAGAGATGATGGAACGA
GGAATTCCTTCTGACAAAAGGACATACAATAGCTTGATTATGGTGCATTTGAAAGAGGGAAAATGTCAAGAAGCCAAGAATCTTGTTGAT
CAGATGAAGGCTAACAGTATCATTCCGAATGATGAAACTTATAATATTTTGGTTGAAGGGCATTGCAAACTTAAAGATTTTTCCGGTGCA
TACATTTGGTACAGAGAGATGGTTGACAACGGTCTTATCCCAGTAGCCAATATTTGTGACGAGTTATTATCTGGCCTTCGAGAGGAAGGA
AGATTGGAAGAGACACAGATTAAATGTTCAGAAATGAGTTCTGAAGGAATTGAAGAGTGTAACACAAATGAGGATATTTCTGCTGTTGXT
GAAATCGTAGGACAGAGAAGACATTGCACTCCAGCTCTTTAG\
Edits in Original Sequence 
(5')XXAGATGCAGGGGACACCGAAAAGTGTTATGACATGTATGAGAAGATGAAAACCTCTGGCATAAAACCTACAATCAACACAATTCA
TCCTCTAATTAGAGCGTCCAAAAAGGGAAAGAATGGACTGGTGTCAATTAACAAAATTGTTGAAGAAATGTCTCAGATGGATCTTTCTCC
TGACCGAGTTGTATATAACGAGCTCATCCATTGCTATGCTCTACATGGAGAAGTTCAAAAGTCACTTGCTATGCACCGAGAGATGATGGA
ACGAGGAATTCCTTCTGACAAAAGGACATACAATAGCTTGATTATGGTGCATTTGAAAGAGGGAAAATGTCAAGAAGCCAAGAATCTTGT
TGATCAGATGAAGGCTAACAGTATCATTCCGAATGATGAAACTTATAATATTTTGGTTGAAGGGCATTGCAAACTTAAAGATTTTTCCGG
TGCATACATTTGGTACAGAGAGATGGTTGACAACGGTCTTATCCCAGTAGCCAATATTTGTGACGAGTTATTATCTGGCCTTCGAGAGGA
AGGAAGATTGGAAGAGACACAGATTAAATGTTCAGAAATGAGTTCTGAAGGAATTGAAGAGTGTAACACAAATGAGGATATTTCTGCTGT
TGXTGAAATCGTAGGACAGAGAAGACATTGCACTCCAGCTCTTTAG\(3')TTTAAAACTTTGGCAGCAAATGAAAAGCTTGTAATATAT
TCAAGAATCAGTATTATTCTTGTTAATTTATTTCCTTGTTGACATTCATTTATTCTCTTATACAAGATGAGATGGATTTCATAGTTTAAA
AAGAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan