ESTScan Details for Unigene SGN-U286428

Score 
1333
Direction 
Forward
Predicted Peptide Sequence 
RALVATNAIAEYLPDEQSGKPSSLPSLLQELKQRASGNMDEPFLNPGISEKQPLHVVMVDPKVSNRSSRFAQEFLSTIIFTIAIGLVWIM
GATALQKYIGGLGGIGASGVGSSSSYAPKELNKEIMPEKNVKTFKDVKGCDDAKQELEEVVEYQKNPSKFTRLGGKLPKGILLTGAPGTG
KTLLAKAIAGEAGVPFFYKAGSEFEEMFVGVGARRVRSLFQAAKKKAPCIIFIDEIDAVGSTRKQWEGHTKKTLHQLLVEMDGFEQNEGI
ILMAATNLPDILDPALTRPGRFDRHIVVPNPDVRGRQEILELYLQDKPVSDDVNVNAIARGTQDSMGADLANLVNIAAIKAAVESAXEAN
ASQLGVAKIEIYGKQTQTMFLSETQKATX
Predicted Coding Sequence 
XTGCGAGCTCTTGTGGCTACAAATGCTATTGCTGAATATCTACCTGATGAACAATCTGGAAAGCCTTCCAGTCTTCCTTCACTGTTGCAA
GAGTTGAAGCAACGGGCATCAGGGAACATGGATGAACCCTTTTTAAATCCTGGCATTTCCGAGAAGCAGCCATTACATGTTGTGATGGTT
GATCCTAAAGTTTCAAACAGATCATCACGTTTCGCGCAAGAGTTTCTCTCAACTATCATATTCACTATTGCCATTGGCTTGGTCTGGATA
ATGGGTGCTACTGCACTTCAGAAATATATTGGTGGCTTAGGTGGGATAGGAGCTTCAGGTGTTGGTTCAAGCTCATCCTATGCCCCGAAA
GAATTGAATAAAGAAATAATGCCTGAGAAGAATGTCAAAACGTTTAAGGATGTCAAAGGTTGTGATGATGCTAAGCAAGAGCTTGAGGAG
GTTGTTGAGTACCAAAAAAATCCTTCTAAGTTCACTCGACTTGGAGGAAAGTTGCCAAAGGGAATTCTTTTGACTGGAGCACCTGGAACA
GGAAAAACTCTCCTTGCCAAGGCTATCGCTGGAGAAGCAGGGGTGCCTTTCTTTTATAAGGCAGGCTCTGAATTTGAAGAAATGTTTGTA
GGAGTTGGTGCTCGGCGTGTGAGATCTTTGTTTCAAGCTGCTAAGAAGAAGGCTCCATGCATCATATTTATTGATGAAATTGATGCTGTT
GGATCAACTCGAAAGCAGTGGGAAGGGCACACTAAGAAAACACTGCATCAATTACTTGTTGAGATGGATGGTTTTGAGCAAAATGAGGGC
ATAATATTGATGGCTGCGACAAACTTGCCTGATATTCTTGATCCTGCCTTGACAAGACCCGGTAGATTTGATAGGCATATTGTGGTTCCC
AATCCAGATGTGCGGGGTCGTCAAGAGATCTTAGAGCTTTATTTGCAAGACAAACCAGTTAGTGATGATGTCAATGTGAATGCGATTGCT
CGTGGAACCCAGGATTCAATGGGAGCAGATTTGGCAAATCTGGTGAATATTGCTGCCATTAAAGCTGCTGTTGAAAGTGCTGXAGAAGCT
AATGCATCACAGTTGGGAGTTGCAAAGATAGAAATATATGGGAAACAGACGCAAACCATGTTCCTTTCAGAGACTCAAAAAGCTACTGXX
\
Edits in Original Sequence 
(5')XTGCGAGCTCTTGTGGCTACAAATGCTATTGCTGAATATCTACCTGATGAACAATCTGGAAAGCCTTCCAGTCTTCCTTCACTGTT
GCAAGAGTTGAAGCAACGGGCATCAGGGAACATGGATGAACCCTTTTTAAATCCTGGCATTTCCGAGAAGCAGCCATTACATGTTGTGAT
GGTTGATCCTAAAGTTTCAAACAGATCATCACGTTTCGCGCAAGAGTTTCTCTCAACTATCATATTCACTATTGCCATTGGCTTGGTCTG
GATAATGGGTGCTACTGCACTTCAGAAATATATTGGTGGCTTAGGTGGGATAGGAGCTTCAGGTGTTGGTTCAAGCTCATCCTATGCCCC
GAAAGAATTGAATAAAGAAATAATGCCTGAGAAGAATGTCAAAACGTTTAAGGATGTCAAAGGTTGTGATGATGCTAAGCAAGAGCTTGA
GGAGGTTGTTGAGTACCtAAAAAAATCCTTCTAAGTTCACTCGACTTGGAGGAAAGTTGCCAAAGGGAATTCTTTTGACTGGAGCACCTG
GAACAGGAAAAACTCTCCTTGCCAAGGCTATCGCTGGAGAAGCAGGGGTGCCTTTCTTTTATAAGGCAGGCTCTGAATTTGAAGAAATGT
TTGTAGGAGTTGGTGCTCGGCGTGTGAGATCTTTGTTTCAAGCTGCTAAGAAGAAGGCTCCATGCATCATATTTATTGATGAAATTGATG
CTGTTGGATCAACTCGAAAGCAGTGGGAAGGGCACACTAAGAAAACACTGCATCAATTACTTGTTGAGATGGATGGTTTTGAGCAAAATG
AGGGCATAATATTGATGGCTGCGACAAACTTGCCTGATATTCTTGATCCTGCCTTGACAAGACCCGGTAGATTTGATAGGCATATTGTGG
TTCCCAATCCAGATGTGCGGGGTCGTCAAGAGATCTTAGAGCTTTATTTGCAAGACAAACCAGTTAGTGATGATGTCAATGTGAATGCGA
TTGCTCGTGGAACCCAGGATTCAATGGGAGCAGATTTGGCAAATCTGGTGAATATTGCTGCCATTAAAGCTGCTGTTGAAAGTGCTGXAG
AAGCTAATGCATCACAGTTGGGAGTTGCAAAGATAGAAATATATGGGAAACAGACGCAAACCATGTTCCTTTCAGAGACTCAAAAAGCTA
CTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan