ESTScan Details for Unigene SGN-U286438

Score 
866
Direction 
Reverse
Predicted Peptide Sequence 
IPWKTQIVCLLQSHDLRGFVDGTIQFPLQTIAPADDDDDVEPEEEEEEKGEEMGNEEYIFQRKRDDGFVKGWIFGSLTDELLQDKAVHKL
DTARQVWLVLEQLYTPKSQDDSSIERAESIESKKDFSYYLQLYRASLSGDWEKAKEFFKGDKEASRAQINSLLQTALHVAVGVKGEKGKH
FVEKLVATIENDEDIAIRDCLGDTPLHYAARFGNLDAAKILVTRNRCLPHIACFSGLYPIHYAAEYGYVSADVFAYFLRVTKDSAPYTDL
SGVRLLYRLIHSDLYDFARELVEEYPDLAKYDSDGKSALKELAMKEFTFLSGSHLNFWQQLLYYCVPVKVNFMESPKEDX
Predicted Coding Sequence 
XACATTCCATGGAAGACCCAGATAGTTTGTCTTCTGCAAAGTCATGATTTACGTGGATTCGTTGATGGAACAATCCAATTTCCTCTACAG
ACCATTGCTCCTGCCGATGATGATGACGACGTTGAACCCGAAGAAGAAGAAGAAGAAAAAGGGGAAGAGATGGGAAATGAGGAATATATA
TTCCAAAGGAAAAGGGATGATGGCTTTGTTAAAGGATGGATCTTCGGTTCTCTTACGGATGAACTTCTTCAGGATAAAGCGGTTCATAAA
TTAGATACCGCTAGACAAGTTTGGTTGGTTTTAGAGCAACTTTACACCCCTAAATCTCAAGATGATAGCAGCATCGAGCGTGCTGAAAGC
ATTGAATCAAAGAAAGATTTTAGCTATTACTTGCAACTATACAGAGCTTCACTAAGTGGAGATTGGGAGAAAGCAAAAGAATTCTTTAAA
GGAGATAAAGAAGCAAGTAGAGCTCAAATCAACTCTCTTTTACAGACAGCACTCCATGTAGCAGTTGGGGTAAAGGGTGAAAAAGGCAAG
CATTTCGTGGAGAAGTTGGTGGCGACTATAGAAAATGATGAAGATATAGCCATACGAGATTGCCTTGGTGATACTCCTCTTCACTATGCT
GCTAGATTTGGCAACTTAGATGCAGCTAAAATCCTTGTAACAAGGAATCGTTGTTTGCCACATATTGCTTGTTTCAGTGGCCTATATCCA
ATCCATTATGCAGCCGAATATGGATACGTTTCTGCGGATGTGTTTGCTTACTTCTTGCGTGTCACTAAAGACTCTGCTCCATATACTGAC
CTCAGTGGTGTTAGGCTTCTCTACAGATTAATCCACTCAGACTTGTATGATTTTGCCAGAGAGTTGGTCGAAGAGTATCCTGATTTGGCA
AAATATGATTCAGACGGAAAATCTGCTTTGAAGGAGCTTGCCATGAAGGAATTTACTTTCCTCAGCGGAAGTCATCTAAACTTTTGGCAA
CAATTACTCTACTATTGTGTTCCTGTCAAAGTCAACTTCATGGAGTCGCCAAAAGAAGACCAX\
Edits in Original Sequence 
(5')XACATTCCATGGAAGACCCAGATAGTTTGTCTTCTGCAAAGTCATGATTTACGTGGATTCGTTGATGGAACAATCCAATTTCCTCT
ACAGACCATTGCTCCTGCCGATGATGATGACGACGTTGAACCCGAAGAAGAAGAAGAAGAAAAAGGGGAAGAGATGGGAAATGAGGAATA
TATATTCCAAAGGAAAAGGGATGATGGCTTTGTTAAAGGATGGATCTTCGGTTCTCTTACGGATGAACTTCTTCAGGATAAAGCGGTTCA
TAAATTAGATACCGCTAGACAAGTTTGGTTGGTTTTAGAGCAACTTTACACCCCTAAATCTCAAGATGATAGCAGCATCGAGCGTGCTGA
AAGCATTGAATCAAAGAAAGATTTTAGCTATTACTTGCAACTATACAGAGCTTCACTAAGTGGAGATTGGGAGAAAGCAAAAGAATTCTT
TAAAGGAGATAAAGAAGCAAGTAGAGCTCAAATCAACTCTCTTTTACAGACAGCACTCCATGTAGCAGTTGGGGTAAAGGGTGAAAAAGG
CAAGCATTTCGTGGAGAAGTTGGTGGCGACTATAGAAAATGATGAAGATATAGCCATACGAGATTGCCTTGGTGATACTCCTCTTCACTA
TGCTGCTAGATTTGGCAACTTAGATGCAGCTAAAATCCTTGTAACAAGGAATCGTTGTTTGCCACATATTGCTTGTTTCAGTGGCCTATA
TCCAATCCATTATGCAGCCGAATATGGATACGTTTCTGCGGATGTGTTTGCTTACTTCTTGCGTGTCACTAAAGACTCTGCTCCATATAC
TGACCTCAGTGGTGTTAGGCTTCTCTACAGATTAATCCACTCAGACTTGTATGATTTTGCCAGAGAGTTGGTCGAAGAGTATCCTGATTT
GGCAAAATATGATTCAGACGGAAAATCTGCTTTGAAGGAGCTTGCCATGAAGGAATTTACTTTCCTCAGCGGAAGTCATCTAAACTTTTG
GCAACAATTACTCTACTATTGTGTTCCTGTCAAAGTCAACTTCATGGAGTCGCCAAAAGAAGACCAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan