ESTScan Details for Unigene SGN-U286497

Score 
668
Direction 
Forward
Predicted Peptide Sequence 
IDLAAMVAKQLDDEPQTLTNSANYESKSHKKQKRKLEDPEVEEVVVESKKEKKKKKKQKQKQEEEGSNGNTETLDGSNGNTEIFDGSAEL
SEKKKSKKEKKSKVKEGNLDDGSDVSVVNGEVKESSTNVVVTGKGADESKYKALEKFVDAGLPSEVLECCKNFEKPSPIQSHSWPFLLDG
RDFIGIARTGSXKTLAFWYSGYYAHHEKRKSKKSKKSVCLVLSPTRELVNKYQ
Predicted Coding Sequence 
XXCATAGATTTGGCAGCCATGGTAGCAAAGCAGTTAGATGACGAACCTCAAACCCTCACTAATTCAGCAAACTATGAATCCAAATCTCAC
AAGAAACAGAAGAGAAAGCTCGAAGACCCTGAGGTTGAAGAAGTTGTTGTAGAATCCAAAAAAGAGAAAAAGAAGAAGAAGAAGCAGAAA
CAGAAGCAAGAAGAAGAAGGGTCTAATGGGAACACTGAAACTCTTGATGGGTCGAATGGAAATACTGAAATATTTGATGGGTCAGCTGAG
TTATCTGAAAAGAAGAAGTCGAAGAAGGAGAAGAAGAGTAAGGTAAAGGAAGGGAATTTGGATGATGGGTCTGATGTTAGTGTTGTTAAT
GGGGAGGTTAAAGAAAGTAGTACAAATGTGGTGGTTACTGGTAAGGGTGCTGATGAGTCAAAGTACAAAGCTTTAGAAAAGTTTGTGGAT
GCAGGGCTTCCAAGTGAGGTGTTGGAATGTTGTAAGAATTTTGAGAAACCATCACCAATTCAATCTCATTCCTGGCCTTTTCTTTTAGAT
GGGCGTGATTTCATTGGGATAGCTAGAACTGGATCANGGAAGACGCTGGCTTTTTGGTATTCCGGCTATTATGCACATCATGAGAAGCGG
AAGAGTAAAAAGTCTAAGAAATCTGTTTGCCTTGTACTTTCGCCTACAAGGGAGCTAGTCAACAAATATCAG\
Edits in Original Sequence 
(5')XXCATAGATTTGaGCAGCCATGGTAGCAAAGCAGTTAGATGACGAACCTCAAACCCTCACTAATTCAGCAAACTATGAATCCAAAT
CTCACAAGAAACAGAAGAGAAAGCTCGAAGACCCTGAGGTTGAAGAAGTTGTTGTAGAATCCAAAAAAGAGAAAAAGAAGAAGAAGAAGC
AGAAACAGAAGCAAGAAGAAGAAGGGTCTAATGGGAACACTGAAACTCTTGATGGGTCGAATGGAAATACTGAAATATTTGATGGGTCAG
CTGAGTTATCTGAAAAGAAGAAGTCGAAGAAGGAGAAGAAGAGTAAGGTAAAGGAAGGGAATTTGGATGATGGGTCTGATGTTAGTGTTG
TTAATGGGGAGGTTAAAGAAAGTAGTACAAATGTGGTGGTTACTGGTAAGGGTGCTGATGAGTCAAAGTACAAAGCTTTAGAAAAGTTTG
TGGATGCAGGGCTTCCAAGTGAGGTGTTGGAATGTTGTAAGAATTTTGAGAAACCATCACCAATTCAATCTCATTCCTGGCCTTTTCTTT
TAGATGGGCGTGATTTCATTGGGATAGCTAGAACTGGATCANGGtAAGACGCTGGCTTTTTGGTATTCCGGCTATTATGCACATCATGAG
tAAGCGGAAGAGTAAAAAGTCTAAGAAATCTGTTTGCCTTGTACTTTCGCCTACAAGGGAGCTAGTCAACAAATATCAG\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan