ESTScan Details for Unigene SGN-U286515

Score 
228
Direction 
Forward
Predicted Peptide Sequence 
MEISTTAMEIGATTMEFGTAAVESGTTVVELAQHGGIQRIGADEKRDESKPPMSLPALTSAACIRVRKFIIVDCLIFDRIEFELYGHAVW
Predicted Coding Sequence 
ATGGAAATCAGCACGACGGCGATGGAAATCGGCGCAACTACAATGGAGTTTGGTACAGCGGCGGTGGAATCTGGCACAACGGTGGTGGAG
TTGGCACAACACGGTGGAATTCAGCGCATCGGTGCTGATGAGAAGAGAGACGAATCAAAGCCTCCGATGTCTCTTCCAGCACTCACCTCA
GCAGCCTGTATTCGTGTAAGAAAATTCATTATCGTCGATTGCCTCATATTCGATCGAATTGAATTCGAACTGTACGGCCATGCCGTTTGG
\
Edits in Original Sequence 
GTGAAAGTCAATTTGTAATATTTTTTAATTTTCCCCCAATTCCTTTTTACTTTGAATTTAACTCCATATTCGCCCTTCAACGAAATTCAA
ATGGTCGGCT
(5')ATGGAAATCAGCACGACGGCGATGGAAATCGGCGCAACTACAATGGAGTTTGGTACAGCGGCGGTGGAATCTGGCA
CAACGGTGGTGGAGTTcGGCACAACACGGTGGAATTCAGCGCATCGGTGCTGATGAGAAGAGAGACGAATCAAAGCCTCCGATGTCTCTT
CCAGCACTCACCTCAGCAGCCTGTATTCGTGTAAGAAAATTCATTATCGTCGATTGCCTCATATTCGATCGAATTGAATTCGAACTGTAC
GGCCATGCCGTTTGG\(3')TGACTACTAATATCCATTTTATTCAGTTTTTTTTTTCTCTGGGGTGGCGTTGCAGCAAAAGGAGAAGGTA
TTTATCCCCTGTTGAGCTGTGAAATCAAAACTGCACTTAATTTGTCTCACTACTGCAATCATAGATTTACAGTGAATTGTTTGTTTACTC
TTACTTTGCCTTTCTTCTTTCGAGCACCATTGGAGTATCGATC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan