ESTScan Details for Unigene SGN-U286527

Score 
188
Direction 
Forward
Predicted Peptide Sequence 
FNLTIGMSNQIAPIDPNVDPYGYLGIIPNTDGSITRSQIPPRPFSTTIPDHDSSVFIKDLVINPVKDTWARIIIPHEVLNSENKLPLVVY
FHGGGFVMAITIDTPILQKFCATLAVEIPAIIVSVDYRYAPENRLPAAYDDCVESLYWIKNTPNELLKKYADFSKCFLLGTSSGGNIAYH
VGLRVAGVSEYLKPLEIKGLILYHSLFGGNERTKSELDXARDKMLPLNVSDIMWELGYLLVAIAIIHIVIPMGGX
Predicted Coding Sequence 
XXGTTCAATTTAACTATTGGCATGTCTAATCAAATTGCTCCAATTGATCCAAATGTCGATCCTTATGGATACTTGGGCATCATTCCCAAC
ACTGATGGCTCTATCACACGTTCCCAAATTCCACCTCGTCCATTTTCCACCACCATTCCTGATCATGATTCCTCCGTCTTTATAAAAGAT
CTCGTCATTAACCCCGTTAAAGATACATGGGCTCGTATTATCATCCCTCATGAAGTACTAAACTCTGAAAATAAACTCCCTCTTGTAGTA
TATTTTCATGGTGGAGGATTTGTAATGGCAATTACTATAGACACACCAATTTTACAAAAATTTTGTGCAACACTTGCGGTTGAAATTCCA
GCGATAATTGTATCGGTCGATTATCGATACGCCCCCGAAAATCGACTCCCAGCAGCGTATGATGATTGTGTGGAATCGTTGTATTGGATC
AAAAATACCCCTAACGAGTTGTTGAAAAAATATGCTGATTTTTCAAAGTGTTTTCTATTGGGCACTAGTTCTGGTGGCAACATAGCGTAC
CACGTAGGACTACGTGTAGCTGGAGTTAGTGAATACCTTAAGCCTTTAGAAATCAAAGGGTTGATTTTATATCATAGTCTTTTTGGTGGA
AATGAAAGGACAAAATCGGAATTAGATXTAGCTCGCGATAAGATGTTGCCCCTTAATGTGAGTGATATTATGTGGGAGCTAGGTTACCTA
TTGGTAGCGATCGCGATCATCCATATTGTAATCCCAATGGGTGGAGXX\
Edits in Original Sequence 
(5')XXGTTCAATTTAACTATTGGCATGTCTAATCAAATTGCTCCAATTGATCCAAATGTCGATCCTTATGGATACTTGGGCATCATTCC
CAACACTGATGGCTCTATCACACGTTCCCAAATTCCACCTCGTCCATTTTCCACCACCATTCCTGATCATGATTCCTCCGTCTTTATAAA
AGATCTCGTCATTAACCCCGTTAAAGATACATGGGCTCGTATTATCATCCCTCATGAAGTACTAAACTCTGAAAATAAACTCCCTCTTGT
AGTATATTTTCATGGTGGAGGATTTGTAATGGCAATTACTATAGACACACCAATTTTACAAAAATTTTGTGCAACACTTGCGGTTGAAAT
TCCAGCGATAATTGTATCGGTCGATTATCGATACGCCCCCGAAAATCGACTCCCAGCAGCGTATGATGATTGTGTGGAATCGTTGTATTG
GATCAAAAATACCCCTAACGAGTTGTTGAAAAAATATGCTGATTTTTCAAAGTGTTTTCTATTGGGCACTAGTTCTGGTGGCAACATAGC
GTACCACGTAGGACTACGTGTAGCTGGAGTTAGTGAATACCTTAAGCCTTTAGAAATCAAAGGGTTGATTTTATATCATAGTCTTTTTGG
TGGAAATGAAAGGACAAAATCGGAATTAGATXTAGCTCGCGATAAGATGTTGCCCCTTAATGTGAGTGATATTATGTGGGAGCTAGGTTA
CCTATTGGTAGCGATCGCGATCATCCATATTGTAATCCCAATGGGTGGAGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan