ESTScan Details for Unigene SGN-U286536

Score 
491
Direction 
Forward
Predicted Peptide Sequence 
MVGFDIQTVGKQLAYILKGETKVKNLKTNKTAAGISITFLGNNLVTGLKLEDQFSIGKQLVVVGSTGTIMSQGNAAYGTNLELRLREKDY
PVGXGPKFTRPFFDEMEKDLIWGCNLQSQFSVGRNSKIAVRAGLNSKKSGQITVKTSTSDQLQIAILGLLPIARAIMMTLFPQTSGKNIM
Predicted Coding Sequence 
ATGGTAGGGTTCGACATTCAAACTGTAGGAAAGCAACTTGCCTATATTTTGAAGGGAGAAACAAAAGTGAAAAATCTGAAAACGAATAAA
ACAGCTGCAGGGATATCCATTACTTTCTTGGGCAACAATTTAGTGACAGGATTGAAATTGGAGGACCAATTTTCCATTGGTAAGCAGTTA
GTTGTGGTGGGAAGTACTGGCACCATCATGTCTCAGGGTAATGCAGCATATGGAACCAACTTAGAGTTACGCCTGAGAGAGAAAGATTAC
CCTGTTGGAXCAGGACCAAAGTTCACTCGGCCTTTCTTTGATGAAATGGAGAAAGATCTCATATGGGGATGCAATCTGCAATCTCAGTTC
TCTGTTGGAAGGAATTCCAAGATTGCTGTTAGGGCCGGATTAAACAGCAAGAAAAGCGGGCAAATCACAGTTAAGACAAGCACTTCAGAT
CAACTACAGATTGCTATTTTAGGACTTCTGCCAATTGCTAGAGCAATAATGATGACCCTTTTTCCTCAGACAAGTGGAAAGAACATAATG
TAG\
Edits in Original Sequence 
AGAAAGGATCAAGT(5')ATGGTAGGGTTCGACATTCAAACTGTAGGAAAGCAACTTGCCTATATTTTGAAGGGAGAAACAAAAGTGAAA
AATCTGAAAACGAATAAAACAGCTGCAGGGATATCCATTACTTTCTTGGGCAACAATTTAGTGACAGGATTGAAATTGGAGGACCAATTT
TCCATTGGTAAGCAGTTAGTTGTGGTGGGAAGTACTGGCACCATCATGTCTCAGGGTAATGCAGCATATGGAACCAACTTAGAGTTACGC
CTGAGAGAGAAAGATTACCCTGTTGGAXCAGGACCAAAGTTCACTCGGCCTTTCTTTGATGAAATGGAGAAAtGATCTCATATGGGGATG
CAATCTGCAATCTCAGTTCTCTGTTGGAAGGAATTCCAAGATTGCTGTTAGGGCCGGATTAAACAGCAAGAAAAGCGGGCAAATCACAGT
TAAGACAAGCACTTCAGATCAACTACAGATTGCTATTTTAGGACTTCTGCCAATTGCTAGAGCAATAATGATGACCCTTTTTCCTCAGAC
AAGTGGAAAGAACATAATGTAG\(3')TTGTTGTATCTTAGACAAATGCCAGTTGCACCTCCATTTTTTTTTAAAAGTTTGTAGTGGTAG
TTTTCTTGTATTTGTCCATTCAATCTCTGAAGTTCTCAATAGAATTACTTCCTTTCTAATCATGAGTTTTACTTAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan