ESTScan Details for Unigene SGN-U286758

Score 
493
Direction 
Reverse
Predicted Peptide Sequence 
LDWLTRVNIIKGVAYALFYMHHDASPPIVHGTYQASNVLLDSEFEARVSDFGIAKILKPDSSNCTALAGTYGYVAPELAYTLKVTEMCDV
YSFGVLALEVIKGKHLGEYLTLLANPSTRDVQLSDLLDERLPHPEDEVKEFLVFIVKLAISCLVENPKSRPXDALHLSYVINGSTQSSDS
MKVRFLEM
Predicted Coding Sequence 
TTGGATTGGCTTACAAGGGTGAATATCATCAAAGGTGTTGCTTATGCTTTATTCTACATGCACCACGATGCTTCACCCCCGATTGTTCAT
GGGACATATCAAGCCAGTAATGTTTTGCTTGACTCCGAGTTTGAAGCTCGTGTTTCTGATTTTGGCATAGCTAAGATTCTCAAGCCAGAC
TCATCCAATTGTACTGCACTTGCAGGCACATATGGCTATGTAGCACCAGAGCTTGCCTATACATTGAAGGTGACGGAAATGTGTGACGTC
TACAGCTTTGGAGTATTAGCATTGGAGGTAATCAAAGGAAAGCATCTTGGGGAATACCTTACTCTTCTAGCAAATCCATCAACAAGAGAT
GTGCAGCTAAGCGATTTGCTAGATGAACGCCTTCCACATCCTGAGGATGAAGTAAAAGAGTTTTTGGTTTTCATCGTCAAGCTAGCAATC
TCATGTTTGGTTGAAAATCCAAAATCAAGGCCAAXTGATGCACTTCATCTCTCATATGTTATCAATGGATCCACCCAATCATCAGATTCC
ATGAAAGTGAGATTCCTTGAAATGTAA\
Edits in Original Sequence 
(5')TTGGATTGGCTTACAAGGGTGAATATCATCAAAGGTGTTGCTTATGCTTTATTCTACATGCACCACGATGCTTCACCCCCGATTGT
TCATcGGGACATATCAAGCCAGTAATGTTTTGCTTGACTCCGAGTTTGAAGCTCGTGTTTCTGATTTTGGCATAGCTAAGATTCTCAAGC
CAGACTCATCCAATTGTACTGCACTTGCAGGCACATATGGCTATGTAGCACCAGAGCTTGCCTATACATTGAAGGTGACGGAAATGTGTG
ACGTCTACAGCTTTGGAGTATTAGCATTGGAGGTAATCAAAGGAAAGCATCTTGGGGAATACCTTACTCTTCTAGCAAATCCATCAACAA
GAGATGTGCAGCTAAGCGATTTGCTAGATGAACGCCTTCCACATCCTGAGGATGAAGTAAAAGAGTTTTTGGTTTTCATCGTCAAGCTAG
CAATCTCATGTTTGGTTGAAAATCCAAAATCAAGGCCAAXTGATGCACTTCATCTCTCATATGTTATCAATGGATCCACCCAATCATCAG
ATTCCATGAAAGTGAGATTCCTTGAAATGTAA\(3')GGTGCCCTGGTATGGAAAAGATTATGCTCAGCACCAAGTGGTTGTGAAGTAAC
AAGTATGTTGATCAGAACTTTCACAGCAAAATATTATTAAGATTAGCCTTTCTGTATTGTTGAGTTGCTTATATAGATTACTTATTTCAA
TCTGAAGGTTTCAGAGCCTTTGTACTAGAATATATACAAATTGCAGTATACTATATACTGAAGTTAAGTAATAAAAGCGGGTTCCATGTT
CGTTAAGTAAAAAGATTTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan