ESTScan Details for Unigene SGN-U286892

Score 
463
Direction 
Forward
Predicted Peptide Sequence 
MYPMNPYQRNQVPYNPHYYPHFESNPHHHMNIDPTRSTLPYESWPCGGSSYGHPYPIXKEEEENPQVVKPFGDIRPFQQPNVWNLWPSHY
GNSSESPKQTGDLPGKQQDDDSIRKQFPFPIIWMPYKPEEDGERVGKETESGLIAEKEPTSPSKLTKPMLHDSEDKRSSSKENEVIYGSE
IRGKGLN
Predicted Coding Sequence 
ATGTATCCCATGAATCCTTACCAACGGAACCAAGTACCTTACAATCCTCATTATTATCCCCACTTCGAATCGAATCCTCATCATCATATG
AACATTGATCCAACTAGATCTACATTACCTTATGAATCTTGGCCTTGTGGTGGTAGCAGCTATGGGCATCCTTATCCAATTGXTAAAGAG
GAGGAGGAGAATCCGCAAGTTGTGAAGCCGTTTGGCGATATCAGGCCCTTCCAGCAACCAAATGTCTGGAATTTATGGCCTTCTCATTAT
GGGAACAGCTCAGAATCACCAAAGCAAACGGGAGATTTACCCGGAAAACAACAAGATGATGATTCGATCAGGAAGCAGTTTCCATTTCCA
ATAATCTGGATGCCTTATAAGCCCGAGGAAGACGGAGAGAGAGTTGGTAAGGAAACTGAGTCTGGCCTCATTGCTGAGAAGGAGCCAACC
TCCCCCTCAAAATTAACCAAACCAATGTTACATGATTCTGAAGACAAGAGAAGCAGTTCTAAAGAAAATGAAGTGATTTACGGAAGTGAA
ATCCGTGGAAAGGGACTGAATTAA\
Edits in Original Sequence 
CCTTAATTGTAATTCTATATACACATAAAAGGGAAGCTTAATTTGGACCTGCATTTGAACCAAGCT(5')ATGTATCCCATGAATCCTTA
CCAACGGAACCAAGTACCTTACAATCCTCATTATTATCCCCACTTCGAATCGAATCCTCATCATCATATGAACATTGATCCAACTAGATC
TACATTACCTTATGAATCTTGGCCTTGTGGTGGTAGCAGCTATGGGCATCCTTATCCAATTGXTAAAGAGGAGGAGGAGAATCCGCAAGT
TGTGAAGCCGTTTGGCGATATCAGGCCCTTCCAGCAACCAAATGTCTGGAATTTATGGCCTTCTCATTATGGGAACAGCTCAGAATCACC
AAAGCAAACGGGAGATTTACCCGGAAAACAACAAGATGATGATTCGATCAGGAAGCAGTTTCCATTTCCAATAATCTGGATGCCTTATAA
GCCCGAGGAAGACGGAGAGAGAGTTGGTAAGGAAACTGAGTCTGGCCTCATTGCTGAGAAGGAGCCAACCTCCCCCTCAAAATTAACCAA
ACCAATGTTACATGATTCTGAAGACAAGAGAAGCAGTTCTAAAGAAAATGAAGTGATTTAgCGGAAGTGAAATCCGTGGAAAGGGACTGA
ATTAA\(3')AGGGACTTGTTGTGCAAAATCATTCCTGTAAAGCAAGTGGAGCAGGATTGAGCATC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan